MZT1 Antibody - middle region (ARP70912_P050)

Catalog No: ARP70912_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: MZT1
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MZT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: LLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MZT1 (ARP70912_P050) antibody is Catalog # AAP70912

Target Info

• Gene Symbol: MZT1
• Alias Symbols: MOZART1, C13orf37
• NCBI Gene Id: 440145
• Protein Name: Mitotic-spindle organizing protein 1
• Description of Target: MZT1 is required for gamma-tubulin complex recruitment to the centrosome.
• Uniprot ID: Q08AG7
• Protein Accession #: NP_001065243
• Nucleotide Accession #: NM_001071775
• Protein Size (# AA): 82
• Molecular Weight: 9kDa
• Protein Interactions: TUBGCP2; TUBGCP3; TUBG1; UBC; Mzt1; Mzt2;