MAK Antibody - C-terminal region (ARP42268_P050)

Catalog No: ARP42268_P050

WB Suggested Anti-MAK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate

Lanes:
1. 30 ug MiaPaca-2 cell lysate
2. 30 ug Panc-1 cell lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Goat anti-Rabbit HRP
Secondary Antibody Dilution:
1:4000
Gene Name:
MAK
Submitted by:
Dr. Crissy Dudgeon, Ph.D., CINJ

Sample Type:
Human lung adenocarcinoma cell line A549
Primary Antibody Dilution:
1:100
Secondary Antibody:
Goat anti-rabbit AlexaFluor 488
Secondary Antibody Dilution:
1:400
Color/Signal Descriptions:
MAK: Green DAPI:Blue
Gene Name:
MAK
Submitted by:
Dr. Crissy Dudgeon, Ph.D., CINJ

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAK
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MAK (ARP42268_P050) antibody is Catalog # AAP42268 (Previous Catalog # AAPP24687)
• Reference: Fu,Z., (2006) Mol. Cell. Biol. 26 (22), 8639-8654

Target Info

• Gene Symbol: MAK
• Gene Full Name: Male germ cell-associated kinase
• Alias Symbols: RP62
• NCBI Gene Id: 4117
• Protein Name: Serine/threonine-protein kinase MAK
• Description of Target: MAK is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.
• Uniprot ID: P20794
• Protein Accession #: NP_005897
• Nucleotide Accession #: NM_005906
• Protein Size (# AA): 623
• Molecular Weight: 70kDa
• Protein Interactions: MAK; SLAMF7; SERINC1; ANAPC11; SND1; PPP2CB; NDUFB7; APP; FZR1; CDK20;