MAGED1 Antibody - C-terminal region (ARP64144_P050)

Catalog No: ARP64144_P050

WB Suggested Anti-MAGED1 Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole CellMAGED1 is supported by BioGPS gene expression data to be expressed in Jurkat

Host: Mouse
Target Name: MAGED1
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGILGTTKDTPKLGLLLV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MAGED1 (ARP64144_P050) antibody is Catalog # AAP64144
• Sample Type Confirmation:

  MAGED1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Info

• Gene Symbol: MAGED1
• Gene Full Name: Melanoma antigen family D, 1
• Alias Symbols: NRAGE, DLXIN-1
• NCBI Gene Id: 9500
• Protein Name: Melanoma-associated antigen D1
• Description of Target: This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene.
• Uniprot ID: Q9Y5V3
• Protein Accession #: NP_008917
• Nucleotide Accession #: NM_006986
• Protein Size (# AA): 778
• Molecular Weight: 86kDa
• Protein Interactions: DAB1; CA8; SMAP2; RBM23; RBFOX2; RBPMS; TFG; AKAP9; BAG3; MAGED1; EIF4E2; BHLHE40; UBC; SNRPC; PRKAB2; C1orf94; RHOXF2; CCDC33; KRTAP19-5; TTC32; ZNF488; BIRC8; TTC23; MEOX2; MDFI; KPNA2; RBFOX1; FBXO7; CEP250; MAGED2; TAB1; MAP3K7; MAPK3; PITX1; XIAP; IR