SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP55421_P050
Price: $0.00
SKU
ARP55421_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HOM-TES-103 Antibody - C-terminal region (ARP55421_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-IFFO1 (ARP55421_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human HOM-TES-103
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: VQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR
Concentration0.5 mg/ml
Blocking PeptideFor anti-IFFO1 (ARP55421_P050) antibody is Catalog # AAP55421 (Previous Catalog # AAPP44793)
Gene SymbolIFFO1
Gene Full NameIntermediate filament family orphan 1
Alias SymbolsIFFO, HOM-TES-103
NCBI Gene Id25900
Description of TargetThis gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed.
Uniprot IDQ0D2I5
Protein Accession #NP_542769
Nucleotide Accession #NM_080731
Protein Size (# AA)200
Molecular Weight23kDa
Protein InteractionsNDN; LATS2; UBD; UBC; GFI1B; XRCC4; RNF183; ACAP1;
  1. What is the species homology for "HOM-TES-103 Antibody - C-terminal region (ARP55421_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "HOM-TES-103 Antibody - C-terminal region (ARP55421_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HOM-TES-103 Antibody - C-terminal region (ARP55421_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HOM-TES-103 Antibody - C-terminal region (ARP55421_P050)"?

    This target may also be called "IFFO, HOM-TES-103" in publications.

  5. What is the shipping cost for "HOM-TES-103 Antibody - C-terminal region (ARP55421_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HOM-TES-103 Antibody - C-terminal region (ARP55421_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HOM-TES-103 Antibody - C-terminal region (ARP55421_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "23kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HOM-TES-103 Antibody - C-terminal region (ARP55421_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IFFO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IFFO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IFFO1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IFFO1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IFFO1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IFFO1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HOM-TES-103 Antibody - C-terminal region (ARP55421_P050)
Your Rating