HBP1 Antibody - N-terminal region (ARP38976_P050)

Catalog No: ARP38976_P050

WB Suggested Anti-HBP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HBP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HBP1 (ARP38976_P050) antibody is Catalog # AAP38976 (Previous Catalog # AAPY00784)
• Reference: Yao,C.J., (2005) Leukemia 19 (11), 1958-1968

Target Info

• Gene Symbol: HBP1
• Gene Full Name: HMG-box transcription factor 1
• NCBI Gene Id: 26959
• Protein Name: HMG box-containing protein 1
• Description of Target: HMG-box containing protein 1 (HBP1) is a member of the high mobility group (HMG) of chromosomal proteins. It is a sequence-specific HMG transcription factor. Several features of HBP1 suggest an intriguing role as a transcriptional and cell cycle regulator in differentiated cells and it may represent a unique transcriptional repressor with a role in initiation and establishment of cell cycle arrest during differentiation.
• Uniprot ID: O60381
• Protein Accession #: NP_036389
• Nucleotide Accession #: NM_012257
• Protein Size (# AA): 514
• Molecular Weight: 58kDa
• Protein Interactions: FBXW11; UBC; TMEM37; SMAD1; ZNF212; KIAA1279; EWSR1; CD2AP; EP300; CREBBP; MYC; ANKRD2; SIN3A; SAP30; TCF4; HDAC1; RBL2; RB1;