Fgfr1 Antibody - N-terminal region (ARP63080_P050)

Catalog No: ARP63080_P050

Host: Rabbit
Target Name: Fgfr1
Sample Type: Mouse Liver lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Fgfr1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Fgfr1 (ARP63080_P050) antibody is Catalog # AAP63080

Target Info

• Gene Symbol: Fgfr1
• Gene Full Name: fibroblast growth factor receptor 1
• Alias Symbols: Ea, Fr, Hs, FLG, Fr1, MFR, Eask, FGFR, Flt-, Hspy, Fgfr-, Flt-2, c-fgr, FGFR-I, Fgfr-1, AW208770, bFGF-R-1
• NCBI Gene Id: 14182
• Protein Name: Fibroblast growth factor receptor 1
• Description of Target: Fgfr1 is a Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. It is required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Fgfr1 phosphorylates PLCG1, FRS2, GAB1 and SHB. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. It promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2. In the nucleus, Fgfr1 enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription. FGFR1 signaling is down-regulated by IL17RD/SEF, and by FGFR1 ubiquitination, internalization and degradation
• Uniprot ID: P16092
• Protein Accession #: NP_034336
• Nucleotide Accession #: NM_010206
• Protein Size (# AA): 822
• Molecular Weight: 92kDa
• Protein Interactions: GZMB; Fgf23; Kl; Frs2;