FGF18 Antibody - C-terminal region (ARP63838_P050)

Catalog No: ARP63838_P050

WB Suggested Anti-FGF18 Antibody
Titration: 1.0 ug/ml
Positive Control: ACHN Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGF18
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FGF18 (ARP63838_P050) antibody is Catalog # AAP63838
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

Target Info

• Gene Symbol: FGF18
• Alias Symbols: ZFGF5, FGF-18
• NCBI Gene Id: 8817
• Protein Name: Fibroblast growth factor 18
• Description of Target: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures.
• Uniprot ID: O76093
• Protein Accession #: NP_003853
• Nucleotide Accession #: NM_003862
• Protein Size (# AA): 207
• Molecular Weight: 24 kDa
• Protein Interactions: LYAR; FGFR2; FGFR1; FGFR4; FGFR3;