DMTF1 Antibody - middle region (ARP34828_P050)

Catalog No: ARP34828_P050

WB Suggested Anti-DMTF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HT1080 cell lysate

Host: Mouse
Target Name: DMTF1
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DMTF1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: TFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DMTF1 (ARP34828_P050) antibody is Catalog # AAP34828 (Previous Catalog # AAPP06037)
• Reference: Tschan,M.P., (2008) Leukemia 22 (5), 1087-1090

Target Info

• Gene Symbol: DMTF1
• Gene Full Name: cyclin D binding myb like transcription factor 1
• Alias Symbols: DMP1, DMTF, MRUL, hDMP1
• NCBI Gene Id: 9988
• Protein Name: cyclin-D-binding Myb-like transcription factor 1
• Description of Target: This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q9Y222
• Protein Accession #: NP_066968
• Nucleotide Accession #: NM_021145
• Protein Size (# AA): 760
• Molecular Weight: 84kDa
• Protein Interactions: SRA1; TP53; ATF7IP; CCND1; CCND3; CCND2;