DBF4B Antibody - N-terminal region (ARP70105_P050)

Catalog No: ARP70105_P050

Host: Rabbit
Target Name: DBF4B
Sample Type: NCI-H226 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DBF4B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 86%; Human: 100%; Pig: 79%
• Peptide Sequence: Synthetic peptide located within the following region: SKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DBF4B (ARP70105_P050) antibody is Catalog # AAP70105

Target Info

• Gene Symbol: DBF4B
• Alias Symbols: DRF1, ASKL1, CHIFB, ZDBF1B
• NCBI Gene Id: 80174
• Protein Name: Protein DBF4 homolog B
• Description of Target: This gene encodes a regulator of the cell division cycle 7 homolog (S. cerevisiae) protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and, in complex with the cell division cycle 7 homolog (S. cerevisiae) protein, may facilitate M phase progression.
• Uniprot ID: Q8NFT6-2
• Protein Size (# AA): 431
• Molecular Weight: 47kDa
• Protein Interactions: LMO2; FUS; KDM1A; SUV39H1; SRPK2; MDFI; PTEN; KRTAP4-12; CDC7; E2F4;