SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: AVARP03047_P050
Price: $0.00
SKU
AVARP03047_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CDKN2B (AVARP03047_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CDKN2B
Predicted Homology Based on Immunogen SequenceDog: 91%; Guinea Pig: 83%; Mouse: 83%; Pig: 100%; Rabbit: 91%; Rat: 83%
Peptide SequenceSynthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Concentration0.5 mg/ml
Blocking PeptideFor anti-CDKN2B (AVARP03047_P050) antibody is Catalog # AAP30194 (Previous Catalog # AAPP00351)
ReferenceScott,S.A., et al., (2004) Leuk. Res. 28 (12), 1293-1301
Gene SymbolCDKN2B
Gene Full NameCyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Alias SymbolsP15, MTS2, TP15, CDK4I, INK4B, p15INK4b
NCBI Gene Id1030
Protein NameCyclin-dependent kinase 4 inhibitor B
Description of TargetCDKN2B's gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. CDKN2B is a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition.
Uniprot IDP42772
Protein Accession #NP_004927
Nucleotide Accession #NM_004936
Protein Size (# AA)138
Molecular Weight15kDa
Protein InteractionsUBC; TRAF1; CDK6; CCDC33; NIF3L1; CDK4; PYCRL; RNF20; TGFB1I1; ISL1; APP; KIAA1377; CCDC90B; ARPC3; ZBTB17; IKBKAP; CDK8; MAGEA11; PIAS2;
  1. What is the species homology for "CDKN2B Antibody - middle region (AVARP03047_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Pig, Rabbit".

  2. How long will it take to receive "CDKN2B Antibody - middle region (AVARP03047_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CDKN2B Antibody - middle region (AVARP03047_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CDKN2B Antibody - middle region (AVARP03047_P050)"?

    This target may also be called "P15, MTS2, TP15, CDK4I, INK4B, p15INK4b" in publications.

  5. What is the shipping cost for "CDKN2B Antibody - middle region (AVARP03047_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CDKN2B Antibody - middle region (AVARP03047_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CDKN2B Antibody - middle region (AVARP03047_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CDKN2B Antibody - middle region (AVARP03047_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CDKN2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CDKN2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CDKN2B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CDKN2B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CDKN2B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CDKN2B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CDKN2B Antibody - middle region (AVARP03047_P050)
Your Rating
We found other products you might like!