website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

CDK4 antibody - C-terminal region (ARP30259_P050)

Receive a free positive control (AHL024) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
Cdk4 is probably involved in the control of the cell cycle.
Gene Symbol:
CDK4
Official Gene Full Name:
Cyclin-dependent kinase 4
NCBI Gene Id:
1019
Alias Symbols:
CMM3; MGC14458; PSK-J3
Sample Type Confirmation:

CDK4 is supported by BioGPS gene expression data to be expressed in HCT116

Tissue Tool:
Find tissues and cell lines supported to express CDK4.
Protein Accession #:
NP_000066
Nucleotide Accession#:
NM_000075
Swissprot Id:
P11802
Host:
Rabbit
Protein Name:
Cyclin-dependent kinase 4
Protein Size (# AA):
303
Molecular Weight:
34kDa
Application:
WB
Partner Proteins:
MYC,BRCA1,CCND1,CCND1,CCND2,CDKN1A,CDKN2A,CDKN2A,CDKN2A,CDKN2A,CDKN2C,RB1,SMAD2,SMAD3,tax,BAG6,BIRC5,BMPR1B,BRCA1,CAPNS1,CCND1,CCND2,CCND3,CDC37,CDC45,CDC7,CDKN1A,CDKN1B,CDKN1C,CDKN2A,CDKN2B,CDKN2C,CDKN2D,CEBPA,CNOT7,IFI27,MCM2,MYOD1,NCOA2,NOL12,ORC3,PPP2R1B,PRKAR1A,PSMD10,PTMA,RB1,RBL1,RFC1,RFC4,SERTAD1,SETDB1,SMAD2,SMAD3,TGFBR1,VTA1,ZNF655,ACTR3B,BAG6,BIRC5,BRCA1,CAPNS1,CCND1,CCND2,CCND3,CDC37,CDKN1A,CDKN1B,CDKN2A,CDKN2B,CDKN2C,CDKN2D,CDT1,CEBPA,CNOT7,DBNL,GEMIN4,HSP82,HSPA8,IME2,LYN,MYOD1,NCOA2,PCNA,PRMT5,RB1,RFC1,RPRM,SAP25,SERTAD1,SETDB1,SMC1A,SMC3,SP1,TSPYL2,UBXN1,VTA1,WDR77
Product Format:
Lyophilized powder
Complete computational species homology data:
CDK4 antibody - C-terminal region (ARP30259_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 92%; Dog: 83%; Rat: 83%; Horse: 83%; Rabbit: 83%; Guinea pig: 83%; Sheep: 75%; Bovine: 75%
Species Reactivity:
Human, Pig, Dog, Horse, Rabbit, Rat, Guinea pig, Sheep, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-CDK4 antibody
- ARP30259_P050
Peptide Sequence:
Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Blocking Peptide:
For anti-CDK4 antibody is Catalog # AAP30259
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CDK4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question