Catalog No: ARP73774_P050
Price: $0.00
SKU
ARP73774_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-BRSK2 (ARP73774_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human BRSK2
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: EEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDPPRKRVDSPMLNRHG
Concentration0.5 mg/ml
Blocking PeptideFor anti-BRSK2 (ARP73774_P050) antibody is Catalog # AAP73774
Gene SymbolBRSK2
Alias SymbolsSAD1, SADA, STK29, PEN11B, C11orf7
NCBI Gene Id9024
Description of TargetBRSK2 is a serine/threonine-protein kinase that plays a key role in polarization of neurons and axonogenesis, cell cycle progress and insulin secretion. It phosphorylates CDK16, CDC25C, MAPT/TAU, PAK1 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a key regulator of polarization of cortical neurons, probably by mediating phosphorylation of microtubule-associated proteins such as MAPT/TAU at 'Thr-529' and 'Ser-579'. It also regulates neuron polarization by mediating phosphorylation of WEE1 at 'Ser-642' in post-mitotic neurons, leading to down-regulate WEE1 activity in polarized neurons. It plays a role in the regulation of the mitotic cell cycle progress and the onset of mitosis. It plays a role in the regulation of insulin secretion in response to elevated glucose levels, probably via phosphorylation of CDK16 and PAK1. While BRSK2 is phosphorylated at Thr-174 can inhibit insulin secretion, BRSK2 is phosphorylated at Thr-260 can promote insulin secretion. It regulates reorganization of the actin cytoskeleton. It may play a role in the apoptotic response triggered by endoplasmatic reticulum (ER) stress.
Uniprot IDQ8IWQ3-5
Protein Size (# AA)766
Molecular Weight84kDa
Protein InteractionsVCP; WEE1; UBC; CDC25C; CDC25B; FZR1; COPS5; PRKAA1; KBTBD7;
  1. What is the species homology for "BRSK2 Antibody - middle region (ARP73774_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "BRSK2 Antibody - middle region (ARP73774_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BRSK2 Antibody - middle region (ARP73774_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BRSK2 Antibody - middle region (ARP73774_P050)"?

    This target may also be called "SAD1, SADA, STK29, PEN11B, C11orf7" in publications.

  5. What is the shipping cost for "BRSK2 Antibody - middle region (ARP73774_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BRSK2 Antibody - middle region (ARP73774_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BRSK2 Antibody - middle region (ARP73774_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "84kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BRSK2 Antibody - middle region (ARP73774_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BRSK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BRSK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BRSK2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BRSK2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BRSK2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BRSK2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BRSK2 Antibody - middle region (ARP73774_P050)
Your Rating
We found other products you might like!