BMP10 Antibody - C-terminal region (ARP47032_P050)

Catalog No: ARP47032_P050

Host: Rabbit
Target Name: BMP10
Sample Type: MCF7 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human BMP10
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BMP10 (ARP47032_P050) antibody is Catalog # AAP47032

Target Info

• Gene Symbol: BMP10
• Gene Full Name: bone morphogenetic protein 10
• Alias Symbols: -
• NCBI Gene Id: 27302
• Protein Name: Bone morphogenetic protein 10
• Description of Target: BMP10 is required for maintaining the proliferative activity of embryonic cardiomyocytes by preventing premature activation of the negative cell cycle regulator CDKN1C/p57KIP and maintaining the required expression levels of cardiogenic factors such as MEF2C and NKX2-5. It acts as a ligand for ACVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, leading to activation of SMAD1, SMAD5 and SMAD8 transcription factors. Inhibits endothelial cell migration and growth.
• Uniprot ID: O95393
• Protein Accession #: NP_055297
• Nucleotide Accession #: NM_014482
• Protein Size (# AA): 424
• Molecular Weight: 46kDa
• Protein Interactions: BMPR2; ACVR2B; ACVR2A; SERINC3;