ARHGDIB Antibody - N-terminal region (ARP61689_P050)

Catalog No: ARP61689_P050

Host: Rabbit
Target Name: ARHGDIB
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/mlARHGDIB is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHGDIB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ARHGDIB (ARP61689_P050) antibody is Catalog # AAP61689
• Sample Type Confirmation:

  ARHGDIB is supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: ARHGDIB
• Alias Symbols: D4, GDIA2, GDID4, LYGDI, Ly-GDI, RAP1GN1, RhoGDI2
• NCBI Gene Id: 397
• Protein Name: Rho GDP-dissociation inhibitor 2
• Description of Target: Members of the Rho (or ARH) protein family and other Ras-related small GTP-binding proteins are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases.
• Uniprot ID: P52566
• Protein Accession #: NP_001166
• Nucleotide Accession #: NM_001175
• Protein Size (# AA): 201
• Molecular Weight: 23kDa
• Protein Interactions: ZBTB1; Rabgef1; Rab6a; APP; UBC; UFM1; RAC3; RAC1; RAC2; RHOH; CASP3; RHOA; VAV1; EZR; CDC42; CUL3; KLHL12;