website statistics

Aviva Systems Biology

Account Login 

Aviva Systems Biology office will be closed on Memorial Day - 5/27/2013.
Please go here for more info.

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
100ug
$229.00
In Stock

RAD17 antibody - C-terminal region (ARP30206_T100)

Description of Target:
RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Eight alternatively spliced transcript variants of this gene, which encode four distinct proteins, have been reported.
Gene Symbol:
RAD17
Official Gene Full Name:
RAD17 homolog (S. pombe)
Alias Symbols:
CCYC; HRAD17; R24L; RAD17Sp; Rad24; RAD24; RAD17SP
Tissue Tool:
Find tissues and cell lines supported to express RAD17.
Protein Accession# :
NP_579919
Nucleotide Accession#:
NM_133341
Swissprot Id:
O75943-4
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
584
Molecular Weight:
66kDa
Application:
WB
Partner Proteins:
CALM1, COPB1, COPB2, ERBB3, GNAI1, GNAI2, GNAO1, GNAQ, PLCB1, PTAFR, COPB2, ERBB3, GNAI1, GNAI1, GNAI2, GNAI2, GNAI3, GNAO1, GNAQ, GNAQ, GNAT1
Immunogen:
The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the C terminal of human RAD17
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
RAD17 antibody - C-terminal region (ARP30206_T100)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Bovine: 83%; Pig: 83%; Dog: 75%; Mouse: 75%; Rat: 75%
Datasheets / Downloads:
Printable datasheet for
anti-RAD17 antibody
- ARP30206_T100
Peptide Sequence:
Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
Blocking Peptide:
For anti-RAD17 antibody is Catalog # AAP30206 (Previous Catalog # AAPS09009)
Key Reference:
Tsao,C.C., (2004) EMBO J. 23 (23), 4660-4669
Reconstitution and Storage:
Add 100 μl of distilled water. Final anti-RAD17 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: RAD17 antibody tested with Human Jurkat Cells (ARP30206_T100)

Aviva Systems Biology is the original manufacturer of this RAD17 antibody (ARP30206_T100)

Click here to view the RAD17 antibody Western Blot Protocol

Product Datasheet Link: RAD17 antibody (ARP30206_T100)

WB Suggested Anti-RAD17 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:


Description of Target: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Eight alternatively spliced transcript variants of this gene, which encode four distinct proteins, have been reported.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s RAD17 antibody (ARP30206_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: RAD17 antibody -C-terminal region (ARP30206_T100) in Hela lysate, HEK293T lysate, Xenopus laevis egg extract and mouse embryonic stem cells using Western Blot

Product Page for RAD17 antibody-C-terminal region (ARP30206_T100)

Application:Western blotting
Researcher:Domenico Maiorano, Institute of Human Genetics, CNRS
Species+tissue/cell type:
Lane1: 25ug Hela lysate
Lane2: 25ug HEK293T lysate
Lane3: 25ug Xenopus laevis egg extract
Lane4: 25ug mouse embryonic stem cells lysate
Primary antibody dilution:1:500
Secondary antibody:Anti-rabbit-HRP
Secondary antibody dilution:1:3000

Questionnaire:
Have you used another antibody which has worked in your application? YES
How did you store the antibody after re-suspension? 4°C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): 1) H. sapiens, M. musculus, X. laevis; 2) Hela cell lysate, mouse embryonic stem cells lysate, Xenopus egg extracts; 3) 25 ug protein per lane.
How many different experimental trials were conducted using the antibody sample? 5
How was this sample prepared? Hela cell and mouse embryonic stem cells lysates were prpared by lysing  cells direct in into Laemmli buffer followed by boiling. Xenopus egg extracts were prepared by low speed (10 000 g) centrifugation of activated layed eggs, followed by inactivation in Laemmli buffer and boiling.
Primary antibody dilution and incubation time: 1:500 in TBS/0.1% Twenn-20, incubated over night at 4°C
Secondary antibody used and dilution and incubation time: 1:3000 in 5% non-fat milk in TBS/0.1% Tween -20
What controls were used in your experiment (positive/negative)? B-actin: positive control.
Please include your detailed WB Procedure/Protocol here: Proteins fractionated on 10% SDS-PAGE were transferred to nitrocellulose membrane (Protran, Whatmann) for 1 hour at 4°C in Tris-glycine buffer supplemented with 20% Ethanol. Membranes were blocked for 1 hour at room temperature with  5% non-fat milk in TBS/0.1% Tween -20. Membranes were incubated over night with primary antibody at 4°C on a shaker. The day after membranes were washed three time for 10 minutes each in TBS/0.1% Tween -20 at room temperature. Membranes were incubated with secondary antibodies in 5% non-fat milk in TBS/0.1% Tween -20 for 4 hours at room temperature on a shaker, then membranes were washed as above and revealed  by ECL (illuminata, crescendo, Millipore).