IRF6 antibody - middle region (ARP31995_P050)

Catalog#: ARP31995_P050

• Size: 50ug

r-IRF6

Human Placenta

• Description of Target: IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction. This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: IRF6
• Official Gene Full Name: Interferon regulatory factor 6
• Alias Symbols: LPS; OFC6; PIT; PPS; VWS; VWS1
• Protein Accession#: NP_006138
• Nucleotide Accession#: NM_006147
• Swissprot Id: O14896
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 467
• Molecular Weight: 53kDa
• Application: WB, IHC
• Partner Proteins: C19orf57, CYTH1, CYTH2, FLAD1, GEM, GGA2, LNX1, POM121, RIBC2, SF1, TRIM23, TRIM27, TRIM29, TRIM31, ZNF250, ZNF581, C19orf57, CYTH1, CYTH2, FLAD1, GEM, GGA2, LNX1, POM121, RIBC2, SF1, TRIM23, TRIM27, TRIM28, TRIM29, TRIM31, TRIM32, TRIM6, ZNF250, ZNF581
• Immunogen: The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the middle region of human IRF6
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; African clawed frog: 92%; Chicken: 92%; Zebrafish: 84%
• Peptide Sequence: Synthetic peptide located within the following region: IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ
• Blocking Peptide: For anti-IRF6 antibody is Catalog # AAP31995 (Previous Catalog # AAPP02892)
• Key Reference: Vieira,A.R., (er) Arch. Oral Biol. (2008) In press
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-IRF6 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: IRF6 antibody tested with Human Transfected 293T Cells (ARP31995_P050)

Aviva Systems Biology is the original manufacturer of this IRF6 antibody (ARP31995_P050)

Click here to view the IRF6 antibody Western Blot Protocol

Product Datasheet Link: IRF6 antibody (ARP31995_P050)

WB Suggested Anti-IRF6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Transfected 293T

Western Blot image:


Description of Target: IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction. This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s IRF6 antibody (ARP31995_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com