website statistics

Aviva Systems Biology

Account Login 

Aviva Systems Biology office will be closed on Memorial Day - 5/27/2013.
Please go here for more info.

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

BRCA1 antibody - N-terminal region (ARP30434_P050)

Description of Target:
The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. BRCA1 acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. BRCA1 plays a central role in DNA repair by facilitating cellular response to DNA repair. BRCA1 is required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. BRCA1 is involved in transcriptional regulation of P21 in response to DNA damage. BRCA1 is also required for FANCD2 targeting to sites of DNA damage.It may function as a transcriptional regulator. BRCA1 inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation.
Gene Symbol:
BRCA1
Official Gene Full Name:
Breast cancer 1, early onset
Alias Symbols:
BRCAI; BRCC1; IRIS; PSCP; RNF53; PNCA4; BROVCA1; PPP1R53
Tissue Tool:
Find tissues and cell lines supported to express BRCA1.
Protein Accession# :
NP_009229
Nucleotide Accession#:
NM_007298
Swissprot Id:
P38398
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
680
Molecular Weight:
76kDa
Application:
WB
Partner Proteins:
ETS2,CREBBP,EP300,MAP3K3,MED1,BRCA1,SMAD2,SMAD3,SMAD4,UBB,ACACA,ATR,BRCA2,CCNA1,CCNB1,CCND1,CDK2,CDK4,CSNK2B,E2F1,E2F4,FANCA,HDAC1,HDAC2,JUN,JUNB,JUND,LMO4,MSH2,MSH6,MYC,NFYA,NMI,NUFIP1,POU2F1,RAD51,RAD51,RB1,RBBP4,RBBP7,RBBP8,SP1,TP53,TP53,ABL1,ACACA,AKT1,AR,ATF1,ATR,AURKA,BAP1,BARD1,BRAP,BRCA1,BRCA2,BRCC3,BRIP1,CASP3,CCNA1,CCNA2,CCNB1,CCND1,CDK1,CDK2,CDK4,CDK7,CHEK2,CLSPN,COBRA1,CREBBP,CSNK2A1,CSNK2B,CSTF1,CTBP1,DCLRE1C,DHX9,E2F1,E2F4,ELK1,EP300,ESR1,FAM175A,FANCA,FANCD2,FHL2,GFI1B,H2AFX,HDAC1,HDAC2,IFI16,JAK1,JAK2,JUN,JUNB,JUND,KPNA2,KPNA6,LMO4,MAP3K3,MDC1,MED1,MED21,MLH1,MNAT1,MYC,NBN,NFKB1,NFYA,NMI,NUFIP1,POLR2A,POLR2K,POU2F1,PPP1CA,PSAP,RAD51,RB1,RBBP4,RBBP7,RBBP8,RELA,RFC1,SMAD2,SMAD3,SMAD4,SMARCA2,SMARCA4,SMC1A,SP1,STAT1,STAT3,STAT5A,TOP2A,TP53,TP53BP1,TRRAP,TUBA4A,TUBB,TUBG1,UBB,UBE2D3,UBE2L3,USF2,VCP,XRCC1,YY1,ZNF350,ABL1,ACACA,AKT1,APLP2,AR,ARNT,ASM4,ATF1,ATM,ATR,AURKA,BACH1,BARD1,BLM,BRAP,BRCA1,BRCA2,BRCC3,BRD7,BRE,BRIP1,CCNA1,CCNA2,CCNB1,CCND1,CCNE1,CCR4,CDK1,CDK16,CDK2,CDK4,CDK5,CDK8,CDKN2D,CDS1,CHEK2,CLSPN,COBRA1,CREB1,CREBBP,CSNK2A1,CSNK2B,CSTF1,CSTF2,CTBP1,CTCFL,DEF1,DHH1,DHX9,DNAJA3,E2F4,ELK4,EP300,ESR1,ETS1,FANCA,FANCD2,FHL2,FLI1,FOXO3,GTF2E1,GTF2F1,GTF2H4,H2AFX,H2AFY,HDAC1,HDAC2,HIST2H2AC,HIST2H3C,HSPA8,Ifi204,JAK1,JAK2,JUN,JUNB,JUND,KAT2A,KIF1B,KPNA2,LMO4,MAP3K3,MAP4K4,MDC1,MED1,MED13,MED17,MED21,MED23,MED24,MLH1,MLP2,MRE11A,MRPL39,MSH2,MSH3,MSH6,MYC,NBN,NCOA2,NCOA3,NFYA,NMI,NPM1,NUFIP1,NUP120,NUP133,NUP153,NUP170,NUP188,NUP2,ORC2,ORC3,PEG3,PIAS1,PIAS4,POLR2A,POM34,POU2F1,PPP1CA,PPP1CB,PPP1R3A,PRKDC,RAD50,RAD51,RB1,RBBP4,RBBP7,RBBP8,RBL1,RBL2,RELA,RFC1,RPA1,RPL31,SMAD3,SMARCA2,SMARCA4,SMARCB1,SMARCC1,SMARCC2,SMARCD2,SP1,SPT4,SPT5,SRC,STAT1,STAT5A,SUB1,SUMO1,SUMO2,TERF1,TERF2,TOP2A,TOP2A,TP53,TP53BP1,TRRAP,TUBG1,UBA1,UBC,UBE2D1,UBE2I,UBE2J1,UBE2L3,UBE3A,UIMC1,USF2,VCP,WDR48,WNT2B,XIST,XRCC5,ZCCHC8,ZNF350
Immunogen:
The immunogen for anti-BRCA1 antibody: synthetic peptide directed towards the N terminal of human BRCA1
Product Format:
Lyophilized powder
Complete computational species homology data:
BRCA1 antibody - N-terminal region (ARP30434_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 92%; Rat: 76%
Datasheets / Downloads:
Printable datasheet for
anti-BRCA1 antibody
- ARP30434_P050
Peptide Sequence:
Synthetic peptide located within the following region: DLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKL
Blocking Peptide:
For anti-BRCA1 antibody is Catalog # AAPP33639
Key Reference:
N/A
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-BRCA1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: BRCA1 antibody tested with Human Achn Cells (ARP30434_P050)

Aviva Systems Biology is the original manufacturer of this BRCA1 antibody (ARP30434_P050)

Click here to view the BRCA1 antibody Western Blot Protocol

Product Datasheet Link: BRCA1 antibody (ARP30434_P050)

WB Suggested Anti-BRCA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN

Western Blot image:


Description of Target: The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. BRCA1 acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. BRCA1 plays a central role in DNA repair by facilitating cellular response to DNA repair. BRCA1 is required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. BRCA1 is involved in transcriptional regulation of P21 in response to DNA damage. BRCA1 is also required for FANCD2 targeting to sites of DNA damage.It may function as a transcriptional regulator. BRCA1 inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s BRCA1 antibody (ARP30434_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com