website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MAP3K14 antibody - N-terminal region (ARP42161_P050)

  • Catalog#: ARP42161_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    In Stock
    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Mitogen-activated protein kinase kinase kinase 14
    Protein Name:
    Mitogen-activated protein kinase kinase kinase 14
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    Replacement Item:
    This antibody may replace item sc-158772 from Santa Cruz Biotechnology.
    Description of Target:
    This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express MAP3K14.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express MAP3K14.
    The immunogen is a synthetic peptide directed towards the N terminal region of human MAP3K14
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-MAP3K14 (ARP42161_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-MAP3K14 (ARP42161_P050) antibody is Catalog # AAP42161 (Previous Catalog # AAPS11910)
    Datasheets / Downloads:
    Printable datasheet for anti-MAP3K14 (ARP42161_P050) antibody

    Product Protocols: MAP3K14 antibody tested with Human Thp-1 Cells (ARP42161_P050)

    Aviva Systems Biology is the original manufacturer of this MAP3K14 antibody (ARP42161_P050)

    Click here to view the MAP3K14 antibody Western Blot Protocol

    Product Datasheet Link: MAP3K14 antibody (ARP42161_P050)

    WB Suggested Anti-MAP3K14 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: THP-1

    Western Blot image:

    Description of Target: This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s MAP3K14 antibody (ARP42161_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question