website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CACNB3 antibody - N-terminal region (ARP34958_P050)

  • Catalog#: ARP34958_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    CACNB3
    NCBI Gene Id:
    784
    Official Gene Full Name:
    Calcium channel, voltage-dependent, beta 3 subunit
    Protein Name:
    Voltage-dependent L-type calcium channel subunit beta-3
    Swissprot Id:
    P54284
    Protein Accession #:
    CAA54056
    Nucleotide Accession #:
    NM_000725
    Alias Symbols:
    CAB3, CACNLB3
    Description of Target:
    The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
    Protein Size (# AA):
    447
    Molecular Weight:
    49kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express CACNB3.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express CACNB3.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the n terminal region of human CACNB3
    Species Reactivity:
    Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
    Complete computational species homology data:
    Anti-CACNB3 (ARP34958_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    FASLG; CACNA1C;
    Blocking Peptide:
    For anti-CACNB3 (ARP34958_P050) antibody is Catalog # AAP34958 (Previous Catalog # AAPP06181)
    Datasheets / Downloads:
    Printable datasheet for anti-CACNB3 (ARP34958_P050) antibody
    Sample Type Confirmation:

    CACNB3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

    Subunit:
    beta-3

    Product Protocols: CACNB3 antibody tested with Human Jurkat Cells (ARP34958_P050)

    Aviva Systems Biology is the original manufacturer of this CACNB3 antibody (ARP34958_P050)

    Click here to view the CACNB3 antibody Western Blot Protocol

    Product Datasheet Link: CACNB3 antibody (ARP34958_P050)

    WB Suggested Anti-CACNB3 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: Jurkat

    Western Blot image:


    Description of Target: The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s CACNB3 antibody (ARP34958_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question