Catalog No: ARP35566_P050
Price: $0.00
SKU
ARP35566_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CACNA1G (ARP35566_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CACNA1G
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS
Concentration0.5 mg/ml
Blocking PeptideFor anti-CACNA1G (ARP35566_P050) antibody is Catalog # AAP35566 (Previous Catalog # AAPP06810)
Subunitalpha-1G
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceOgino,S., (2007) J Mol Diagn 9 (3), 305-314
Gene SymbolCACNA1G
Gene Full NameCalcium channel, voltage-dependent, T type, alpha 1G subunit
Alias SymbolsNBR13, SCA42, Cav3.1, SCA42ND, Ca(V)T.1
NCBI Gene Id8913
Protein NameVoltage-dependent T-type calcium channel subunit alpha-1G
Description of TargetVoltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance. See MIM 601011. Low-voltage-activated calcium channels are referred to as 'T' type because their currents are both tra
Uniprot IDO43497
Protein Accession #NP_938202
Nucleotide Accession #NM_198388
Protein Size (# AA)2171
Molecular Weight241 kDa
Protein InteractionsRANBP9; UBQLN4;
  1. What is the species homology for "CACNA1G Antibody - C - terminal region (ARP35566_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CACNA1G Antibody - C - terminal region (ARP35566_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CACNA1G Antibody - C - terminal region (ARP35566_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CACNA1G Antibody - C - terminal region (ARP35566_P050)"?

    This target may also be called "NBR13, SCA42, Cav3.1, SCA42ND, Ca(V)T.1" in publications.

  5. What is the shipping cost for "CACNA1G Antibody - C - terminal region (ARP35566_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CACNA1G Antibody - C - terminal region (ARP35566_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CACNA1G Antibody - C - terminal region (ARP35566_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "241 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CACNA1G Antibody - C - terminal region (ARP35566_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CACNA1G"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CACNA1G"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CACNA1G"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CACNA1G"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CACNA1G"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CACNA1G"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CACNA1G Antibody - C - terminal region (ARP35566_P050)
Your Rating
We found other products you might like!