website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

NFKB2 antibody - N-terminal region (ARP32718_P050)

Description of Target:
NFKB has been detected in numerous cell types that express cytokines, chemokines, growth factors, cell adhesion molecules, and some acute phase proteins in health and in various disease states. NFKB is activated by a wide variety of stimuli such as cytokines, oxidant-free radicals, inhaled particles, ultraviolet irradiation, and bacterial or viral products. Inappropriate activation of NF-kappa-B has been linked to inflammatory events associated with autoimmune arthritis, asthma, septic shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. In contrast, complete and persistent inhibition of NF-kappa-B has been linked directly to apoptosis, inappropriate immune cell development, and delayed cell growth.
Gene Symbol:
NFKB2
Official Gene Full Name:
Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
Alias Symbols:
p52; p105; H2TF1; LYT10; LYT-10; NF-kB2
Tissue Tool:
Find tissues and cell lines supported to express NFKB2.
Protein Accession# :
NP_002493
Nucleotide Accession#:
NM_002502
Swissprot Id:
Q00653
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
933
Molecular Weight:
101kDa
Application:
WB, IHC
Immunogen:
The immunogen for anti-NFKB2 antibody: synthetic peptide directed towards the N terminal of human NFKB2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
NFKB2 antibody - N-terminal region (ARP32718_P050)
Predicted Homology Based on Immunogen Sequence:
Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 84%
Datasheets / Downloads:
Printable datasheet for
anti-NFKB2 antibody
- ARP32718_P050
Peptide Sequence:
Synthetic peptide located within the following region: LPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQC
Blocking Peptide:
For anti-NFKB2 antibody is Catalog # AAP32718 (Previous Catalog # AAPP03732)
Key Reference:
Xiao,G., et al., (2004) J. Biol. Chem. 279 (29), 30099-30105
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-NFKB2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: NFKB2 antibody tested with Human Raji Cells (ARP32718_P050)

Aviva Systems Biology is the original manufacturer of this NFKB2 antibody (ARP32718_P050)

Click here to view the NFKB2 antibody Western Blot Protocol

Product Datasheet Link: NFKB2 antibody (ARP32718_P050)

WB Suggested Anti-NFKB2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Raji

Western Blot image:


Description of Target: NFKB has been detected in numerous cell types that express cytokines, chemokines, growth factors, cell adhesion molecules, and some acute phase proteins in health and in various disease states. NFKB is activated by a wide variety of stimuli such as cytokines, oxidant-free radicals, inhaled particles, ultraviolet irradiation, and bacterial or viral products. Inappropriate activation of NF-kappa-B has been linked to inflammatory events associated with autoimmune arthritis, asthma, septic shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. In contrast, complete and persistent inhibition of NF-kappa-B has been linked directly to apoptosis, inappropriate immune cell development, and delayed cell growth.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s NFKB2 antibody (ARP32718_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: NFKB2 antibody tested by IHC with human lung (ARP32718)

Aviva Systems Biology is the original manufacturer of this NFKB2 antibody.

Click here to view the NFKB2 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: NFKB2 antibody (ARP32718)

IHC Information:

Rabbit Anti-NFKB2 Antibody
Catalog Number: ARP32718
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: