website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

MAP3K14 antibody - N-terminal region (ARP42161_P050)

Description of Target:
This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.
Gene Symbol:
Official Gene Full Name:
Mitogen-activated protein kinase kinase kinase 14
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAP3K14.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAP3K14.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Mitogen-activated protein kinase kinase kinase 14
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-MAP3K14 antibody: synthetic peptide directed towards the N terminal of human MAP3K14
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
MAP3K14 antibody - N-terminal region (ARP42161_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Rat, Bovine, Dog, Pig, Horse, Rabbit, Mouse, Human, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-MAP3K14 antibody
- ARP42161_P050
Peptide Sequence:
Synthetic peptide located within the following region: SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
Blocking Peptide:
For anti-MAP3K14 antibody is Catalog # AAP42161 (Previous Catalog # AAPS11910)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: MAP3K14 antibody tested with Human Thp-1 Cells (ARP42161_P050)

Aviva Systems Biology is the original manufacturer of this MAP3K14 antibody (ARP42161_P050)

Click here to view the MAP3K14 antibody Western Blot Protocol

Product Datasheet Link: MAP3K14 antibody (ARP42161_P050)

WB Suggested Anti-MAP3K14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1

Western Blot image:

Description of Target: This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s MAP3K14 antibody (ARP42161_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question