website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

MAP3K14 antibody - N-terminal region (ARP42161_P050)

Description of Target:
This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.
Gene Symbol:
MAP3K14
Official Gene Full Name:
Mitogen-activated protein kinase kinase kinase 14
NCBI Gene Id:
9020
Alias Symbols:
FTDCR1B; HS; HSNIK; NIK
Tissue Tool:
Find tissues and cell lines supported to express MAP3K14.
Protein Accession #:
NP_003945
Nucleotide Accession#:
NM_003954
Swissprot Id:
Q99558
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Mitogen-activated protein kinase kinase kinase 14
Protein Size (# AA):
947
Molecular Weight:
104kDa
Application:
WB
Partner Proteins:
CHUK, IKBKAP, IKBKB, TRAF1, TRAF2, TRAF3, TRAF5, TRAF6, ALPL, CASP8, CDC37, CHUK, EDAR, EGFR, FBL, GRB10, GRB14, GRB7, HSP90AA1, HSP90AB1, IKBKAP, IKBKB, IKBKG, MAP2K4, MAP3K14, MAP3K7, MAP3K8, MAPK3, NFKB2, PEBP1, PELI3, RIPK1, RPL30, RPL4, RPL5, RPL6, RPS11, RPS13, TRAF1, TRAF2, TRAF3, TRAF5, TRAF6, CASP10, CASP3, CASP8, CFLAR, CHUK, EGFR, IKBKAP, IKBKB, IKBKG, MAP3K14, MAP3K7, MAP3K8, NFKB2, NFKBIA, Pebp1, RIPK1, TRAF1, TRAF2, TRAF3, TRAF6, Traf6
Immunogen:
The immunogen for anti-MAP3K14 antibody: synthetic peptide directed towards the N terminal of human MAP3K14
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
MAP3K14 antibody - N-terminal region (ARP42161_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Rat, Bovine, Dog, Pig, Horse, Rabbit, Mouse, Human, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-MAP3K14 antibody
- ARP42161_P050
Peptide Sequence:
Synthetic peptide located within the following region: SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
Blocking Peptide:
For anti-MAP3K14 antibody is Catalog # AAP42161 (Previous Catalog # AAPS11910)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-MAP3K14 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question