website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

MAP3K14 antibody - N-terminal region (ARP42161_P050)

Description of Target:
This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.
Gene Symbol:
Official Gene Full Name:
Mitogen-activated protein kinase kinase kinase 14
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express MAP3K14.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Mitogen-activated protein kinase kinase kinase 14
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-MAP3K14 antibody: synthetic peptide directed towards the N terminal of human MAP3K14
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
MAP3K14 antibody - N-terminal region (ARP42161_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Rat, Bovine, Dog, Pig, Horse, Rabbit, Mouse, Human, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-MAP3K14 antibody
- ARP42161_P050
Peptide Sequence:
Synthetic peptide located within the following region: SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
Blocking Peptide:
For anti-MAP3K14 antibody is Catalog # AAP42161 (Previous Catalog # AAPS11910)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for MAP3K14 antibody (ARP42161)

Product page for MAP3K14 antibody (ARP42161)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant MAP3K14 antibody; Loxodonta africana MAP3K14 antibody G3UB99 100%
African elephant MAP3K14 antibody; Loxodonta africana MAP3K14 antibody G3SW32 100%
Bovine MAP3K14 antibody; Bos taurus MAP3K14 antibody E1BL08 100%
Chicken MAP3K14 antibody; Gallus gallus MAP3K14 antibody Q5F350 92%
Chicken MAP3K14 antibody; Gallus gallus MAP3K14 antibody F1NRW0 92%
Chicken MAP3K14 antibody; Gallus gallus MAP3K14 antibody F1NMZ5 92%
Common turkey MAP3K14 antibody; Meleagris gallopavo MAP3K14 antibody G3UPS3 92%
Common turkey MAP3K14 antibody; Meleagris gallopavo MAP3K14 antibody G1NEI6 92%
Dog MAP3K14 antibody; Canis familiaris MAP3K14 antibody E2QTT7 100%
Gray short-tailed opossum MAP3K14 antibody; Monodelphis domestica MAP3K14 antibody F7AN11 100%
Guinea pig LOC100719582 antibody; Cavia porcellus LOC100719582 antibody H0V427 92%
Horse MAP3K14 antibody; Equus caballus MAP3K14 antibody F7DNE2 100%
Horse MAP3K14 antibody; Equus caballus MAP3K14 antibody F7DMN2 100%
Human M3K14 antibody; Homo sapiens M3K14 antibody Q99558 100%
Little brown bat MAP3K14 antibody; Myotis lucifugus MAP3K14 antibody G1P548 100%
Lowland gorilla MAP3K14 antibody; Gorilla gorilla gorilla MAP3K14 antibody G3QPG2 100%
Mouse M3K14 antibody; Mus musculus M3K14 antibody Q9WUL6 100%
Mouse Map3k14 antibody; Mus musculus Map3k14 antibody Q544K4 100%
Mouse Map3k14 antibody; Mus musculus Map3k14 antibody Q3KNY7 100%
Northern white-cheeked gibbon LOC100600394 antibody; Nomascus leucogenys LOC100600394 antibody G1QYP6 100%
Pig MAP3K14 antibody; Sus scrofa MAP3K14 antibody F1RR25 100%
Rabbit MAP3K14 antibody; Oryctolagus cuniculus MAP3K14 antibody G1SHZ7 100%
Rat Map3k14 antibody; Rattus norvegicus Map3k14 antibody D3ZTD1 100%
Rhesus macaque MAP3K14 antibody; Macaca mulatta MAP3K14 antibody F7B742 100%
Small-eared galago MAP3K14 antibody; Otolemur garnettii MAP3K14 antibody H0XQA4 100%
Tasmanian devil MAP3K14 antibody; Sarcophilus harrisii MAP3K14 antibody G3WE22 100%
White-tufted-ear marmoset MAP3K14 antibody; Callithrix jacchus MAP3K14 antibody F7IKI4 100%
Zebra finch MAP3K14 antibody; Taeniopygia guttata MAP3K14 antibody H0YV52 92%

Product Protocols: MAP3K14 antibody tested with Human Thp-1 Cells (ARP42161_P050)

Aviva Systems Biology is the original manufacturer of this MAP3K14 antibody (ARP42161_P050)

Click here to view the MAP3K14 antibody Western Blot Protocol

Product Datasheet Link: MAP3K14 antibody (ARP42161_P050)

WB Suggested Anti-MAP3K14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1

Western Blot image:

Description of Target: This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s MAP3K14 antibody (ARP42161_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question