website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

CACNB3 antibody - N-terminal region (ARP34958_P050)

Description of Target:
The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Gene Symbol:
Official Gene Full Name:
Calcium channel, voltage-dependent, beta 3 subunit
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

CACNB3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express CACNB3.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Voltage-dependent L-type calcium channel subunit beta-3
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the n terminal of human CACNB3
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
CACNB3 antibody - N-terminal region (ARP34958_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 92%
Species Reactivity:
Zebrafish, Rat, Pig, Human, Guinea pig, Mouse, Rabbit, Bovine, Dog
Datasheets / Downloads:
Printable datasheet for
anti-CACNB3 antibody
- ARP34958_P050
Peptide Sequence:
Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ
Blocking Peptide:
For anti-CACNB3 antibody is Catalog # AAP34958 (Previous Catalog # AAPP06181)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CACNB3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for CACNB3 antibody (ARP34958)

Product page for CACNB3 antibody (ARP34958)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog cacnb3-a antibody; Xenopus laevis cacnb3-a antibody Q91629 92%
African clawed frog cacnb3-b antibody; Xenopus laevis cacnb3-b antibody Q91630 85%
African elephant CACNB3 antibody; Loxodonta africana CACNB3 antibody G3TCU2 100%
Bovine CACB3 antibody; Bos taurus CACB3 antibody Q9MZL3 100%
Chicken CACNB4 antibody; Gallus gallus CACNB4 antibody Q804I5 100%
Chicken CACNB4 antibody; Gallus gallus CACNB4 antibody Q804I4 100%
Chicken CACNB4 antibody; Gallus gallus CACNB4 antibody B6IDG5 100%
Dog CACNB3 antibody; Canis familiaris CACNB3 antibody E2R0H2 91%
Duckbill platypus CACNB4 antibody; Ornithorhynchus anatinus CACNB4 antibody B6IDG4 92%
Gray short-tailed opossum CACNB4 antibody; Monodelphis domestica CACNB4 antibody B6IDG2 100%
Green anole cacnb4 antibody; Anolis carolinensis cacnb4 antibody B6IDG0 100%
Guinea pig LOC100730569 antibody; Cavia porcellus LOC100730569 antibody H0V0H3 100%
Human CACB3 antibody; Homo sapiens CACB3 antibody P54284 100%
Human CACB3 antibody; Homo sapiens CACB3 antibody P54284-2 100%
Human CACB4 antibody; Homo sapiens CACB4 antibody O00305-2 92%
Human CACNB3 antibody; Homo sapiens CACNB3 antibody F8VWK1 100%
Human CACNB3 antibody; Homo sapiens CACNB3 antibody F8VSG3 100%
Human CACNB3 antibody; Homo sapiens CACNB3 antibody F8VNV8 100%
Human CACNB4 antibody; Homo sapiens CACNB4 antibody F8WA06 92%
Japanese pufferfish CACNB4.1 antibody; Takifugu rubripes CACNB4.1 antibody B6IDE9 92%
Japanese pufferfish CACNB4.2 antibody; Takifugu rubripes CACNB4.2 antibody B6IDF1 100%
Leiolepis reevesii rubritaeniata CACNB4 antibody D0VXZ3 100%
Little brown bat CACNB3 antibody; Myotis lucifugus CACNB3 antibody G1PH83 100%
Lowland gorilla CACNB3 antibody; Gorilla gorilla gorilla CACNB3 antibody G3RGW2 100%
Medaka fish cacnb4.1 antibody; Oryzias latipes cacnb4.1 antibody B6IDF8 100%
Mouse CACB3 antibody; Mus musculus CACB3 antibody P54285 100%
Mouse CACB4 antibody; Mus musculus CACB4 antibody Q8R0S4-1 100%
Mouse Cacnb3 antibody; Mus musculus Cacnb3 antibody Q8K5A7 100%
Mouse Cacnb3 antibody; Mus musculus Cacnb3 antibody G5E821 100%
Mouse Cacnb4 antibody; Mus musculus Cacnb4 antibody A2ATZ6 100%
Northern white-cheeked gibbon CACNB3 antibody; Nomascus leucogenys CACNB3 antibody G1S869 78%
Pig CACNB3 antibody; Sus scrofa CACNB3 antibody F1SPN4 100%
Rabbit CACB3 antibody; Oryctolagus cuniculus CACB3 antibody P54286 100%
Rat CACB3 antibody; Rattus norvegicus CACB3 antibody P54287 100%
Rat Cacnb4 antibody; Rattus norvegicus Cacnb4 antibody D4A055 100%
Rhesus macaque CACNB3 antibody; Macaca mulatta CACNB3 antibody F6VB97 100%
Rhesus macaque CACNB4 antibody; Macaca mulatta CACNB4 antibody F7G9Z3 92%
Small-eared galago CACNB3 antibody; Otolemur garnettii CACNB3 antibody H0XN99 100%
Spotted green pufferfish CACNB4.1 antibody; Tetraodon nigroviridis CACNB4.1 antibody B6IDF3 92%
Spotted green pufferfish CACNB4.2 antibody; Tetraodon nigroviridis CACNB4.2 antibody B6IDF4 100%
Three-spined stickleback CACNB4 (1 of 2) antibody; Gasterosteus aculeatus CACNB4 (1 of 2) antibody G3PPK4 100%
Three-spined stickleback CACNB4.1 antibody; Gasterosteus aculeatus CACNB4.1 antibody B6IDF6 100%
Western clawed frog cacnb4 antibody; Xenopus tropicalis cacnb4 antibody B5DDZ7 100%
White-tufted-ear marmoset CACNB3 antibody; Callithrix jacchus CACNB3 antibody F7HQ16 100%
White-tufted-ear marmoset CACNB4 antibody; Callithrix jacchus CACNB4 antibody F7GGT8 92%
Zebra finch CACNB4 antibody; Taeniopygia guttata CACNB4 antibody H0ZPB9 100%
Zebrafish cacnb4a antibody; Danio rerio cacnb4a antibody A8WHZ5 100%
Zebrafish cacnb4a antibody; Danio rerio cacnb4a antibody A2SZ57 100%
Zebrafish cacnb4b antibody; Danio rerio cacnb4b antibody Q1RM19 100%
Zebrafish cacnb4b antibody; Danio rerio cacnb4b antibody F1QEK9 100%
Zebrafish cacnb4b antibody; Danio rerio cacnb4b antibody B0F0C8 100%
Zebrafish cacnb4b antibody; Danio rerio cacnb4b antibody B0F0C6 100%
Zebrafish cacnb4b antibody; Danio rerio cacnb4b antibody A2SZ58 100%
Zebrafish CH211-107M8.1 antibody; Danio rerio CH211-107M8.1 antibody B0UXW5 100%

Product Protocols: CACNB3 antibody tested with Human Jurkat Cells (ARP34958_P050)

Aviva Systems Biology is the original manufacturer of this CACNB3 antibody (ARP34958_P050)

Click here to view the CACNB3 antibody Western Blot Protocol

Product Datasheet Link: CACNB3 antibody (ARP34958_P050)

WB Suggested Anti-CACNB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:

Description of Target: The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CACNB3 antibody (ARP34958_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question