website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

CACNB3 antibody - N-terminal region (ARP34958_P050)

Description of Target:
The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Gene Symbol:
Official Gene Full Name:
Calcium channel, voltage-dependent, beta 3 subunit
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

CACNB3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express CACNB3.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Voltage-dependent L-type calcium channel subunit beta-3
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the n terminal of human CACNB3
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
CACNB3 antibody - N-terminal region (ARP34958_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 92%
Species Reactivity:
Zebrafish, Rat, Pig, Human, Guinea pig, Mouse, Rabbit, Bovine, Dog
Datasheets / Downloads:
Printable datasheet for
anti-CACNB3 antibody
- ARP34958_P050
Peptide Sequence:
Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ
Blocking Peptide:
For anti-CACNB3 antibody is Catalog # AAP34958 (Previous Catalog # AAPP06181)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CACNB3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question