website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

CACNB3 antibody - N-terminal region (ARP34958_P050)

Description of Target:
The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Gene Symbol:
Official Gene Full Name:
Calcium channel, voltage-dependent, beta 3 subunit
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

CACNB3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express CACNB3.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Voltage-dependent L-type calcium channel subunit beta-3
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the n terminal of human CACNB3
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
CACNB3 antibody - N-terminal region (ARP34958_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 92%
Species Reactivity:
Zebrafish, Rat, Pig, Human, Guinea pig, Mouse, Rabbit, Bovine, Dog
Datasheets / Downloads:
Printable datasheet for
anti-CACNB3 antibody
- ARP34958_P050
Peptide Sequence:
Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ
Blocking Peptide:
For anti-CACNB3 antibody is Catalog # AAP34958 (Previous Catalog # AAPP06181)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: CACNB3 antibody tested with Human Jurkat Cells (ARP34958_P050)

Aviva Systems Biology is the original manufacturer of this CACNB3 antibody (ARP34958_P050)

Click here to view the CACNB3 antibody Western Blot Protocol

Product Datasheet Link: CACNB3 antibody (ARP34958_P050)

WB Suggested Anti-CACNB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:

Description of Target: The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CACNB3 antibody (ARP34958_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question