- Description of Target:
- NFATC4 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. NFATC4 plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
- Gene Symbol:
- NFATC4
- Official Gene Full Name:
- Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4
- Alias Symbols:
- NF-ATc4; NFAT3
- Tissue Tool:
- Find tissues and cell lines supported to express NFATC4.

- Protein Accession# :
- NP_004545
- Nucleotide Accession#:
- NM_004554
- Swissprot Id:
- Q14934
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 902
- Molecular Weight:
- 95kDa
- Application:
- WB
- Partner Proteins:
- NFKB2, CUL1, IL1A, JUP, NFKB1, NFKB2, PPP6C, REL, RELA, SKP1, JUP, NFKB1, NFKB2, REL, RELA
- Immunogen:
- The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the N terminal of human NFATC4
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- NFATC4 antibody - N-terminal region (ARP38493_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-NFATC4 antibody
- ARP38493_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGE
- Blocking Peptide:
- For anti-NFATC4 antibody is Catalog # AAP38493 (Previous Catalog # AAPS04304)
- Key Reference:
- Diedrichs,H., (2007) J. Int. Med. Res. 35 (6), 803-818
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-NFATC4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: NFATC4 antibody tested with Human 721_B_Lymphoblast (ARP38493_P050)
Aviva Systems Biology is the original manufacturer of this NFATC4 antibody (ARP38493_P050)
Click here to view the NFATC4 antibody Western Blot Protocol
Product Datasheet Link: NFATC4 antibody (ARP38493_P050)
WB Suggested Anti-NFATC4 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B
Western Blot image: 
Description of Target: NFATC4 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. NFATC4 plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s NFATC4 antibody (ARP38493_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


