- Description of Target:
- L-type calcium channels are composed of five subunits. The protein encoded by CACNG6 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. CACNG6 is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.
- Gene Symbol:
- CACNG6
- Official Gene Full Name:
- Calcium channel, voltage-dependent, gamma subunit 6
- Tissue Tool:
- Find tissues and cell lines supported to express CACNG6.

- Protein Accession# :
- NP_665814
- Nucleotide Accession#:
- NM_145815
- Swissprot Id:
- Q9BXT2
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 214
- Molecular Weight:
- 24kDa
- Application:
- WB
- Partner Proteins:
- CALM1, FYN, HCK, ITCH, LCK, LYN, MAP7, PACSIN1, PACSIN2, PACSIN3, SRC, TRPV4, YES1, FYN, HCK, LCK, LYN, MAP7, OS9, PACS1, SRC, UBC, YES1
- Immunogen:
- The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- CACNG6 antibody - N-terminal region (ARP35414_T100)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Mouse: 91%; Dog: 90%
- Datasheets / Downloads:
- Printable datasheet for
anti-CACNG6 antibody
- ARP35414_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN
- Blocking Peptide:
- For anti-CACNG6 antibody is Catalog # AAP35414 (Previous Catalog # AAPP06652)
- Key Reference:
- Chu,P.J., et al., (2001) Gene 280 (1-2), 37-48
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-CACNG6 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: CACNG6 antibody tested with Human Hepg2 Cells (ARP35414_T100)
Aviva Systems Biology is the original manufacturer of this CACNG6 antibody (ARP35414_T100)
Click here to view the CACNG6 antibody Western Blot Protocol
Product Datasheet Link: CACNG6 antibody (ARP35414_T100)
WB Suggested Anti-CACNG6 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2
Western Blot image: 
Description of Target: L-type calcium channels are composed of five subunits. The protein encoded by CACNG6 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. CACNG6 is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s CACNG6 antibody (ARP35414_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


