CACNG4 antibody - N-terminal region (ARP37694_T100)

Catalog#: ARP37694_T100

• Size: 100ug

Human Jurkat

• Description of Target: L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.
• Gene Symbol: CACNG4
• Official Gene Full Name: Calcium channel, voltage-dependent, gamma subunit 4
• Protein Accession#: NP_055220
• Nucleotide Accession#: NM_014405
• Swissprot Id: Q9UBN1
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 327
• Molecular Weight: 36kDa
• Application: WB
• Immunogen: The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Mouse: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL
• Blocking Peptide: For anti-CACNG4 antibody is Catalog # AAP37694 (Previous Catalog # AAPS05308)
• Key Reference: Moss,F.J., (er) Gene 4, 23 (2003)
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-CACNG4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: CACNG4 antibody tested with Human Jurkat Cells (ARP37694_T100)

Aviva Systems Biology is the original manufacturer of this CACNG4 antibody (ARP37694_T100)

Click here to view the CACNG4 antibody Western Blot Protocol

Product Datasheet Link: CACNG4 antibody (ARP37694_T100)

WB Suggested Anti-CACNG4 Antibody Titration: 0.31ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CACNG4 antibody (ARP37694_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com