CACNB4 antibody - middle region (ARP36763_P050)

Catalog#: ARP36763_P050

• Size: 50ug

Human MCF-7

• Description of Target: CACNB4 is a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME).
• Gene Symbol: CACNB4
• Official Gene Full Name: Calcium channel, voltage-dependent, beta 4 subunit
• Alias Symbols: EA5; EJM; CAB4; EIG9; EJM4; EJM6; CACNLB4
• Protein Accession#: NP_001139270
• Nucleotide Accession#: NM_000726
• Swissprot Id: A7BJ74
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 458
• Molecular Weight: 50kDa
• Application: WB
• Subunit: beta-4
• Partner Proteins: PRKACA, REM1
• Immunogen: The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Mouse:100%; American bullfrog:100%; Leiolepis reevesii rubritaeniata:100%; Rat:100%; Dog:100%; Rabbit:100%; Bovine:100%; Sumatran orangutan:100%; Pig:100%; Guinea pig:100%; Chicken:100%; Duckbill platypus:100%; Zebrafish:100%; African clawed frog:100%; Western clawed frog:100%; Japanese pufferfish:100%; Green puffer:100%; Three-spined stickleback:100%; Medaka fish:100%; Green anole:100%; Short-tailed gray opossum:100%; Human:100%; 
• Peptide Sequence: Synthetic peptide located within the following region: GVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDP
• Blocking Peptide: For anti-CACNB4 antibody is Catalog # AAP36763 (Previous Catalog # AAPS07508)
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-CACNB4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: CACNB4 antibody tested with Human Mcf7 Cells (ARP36763_P050)

Aviva Systems Biology is the original manufacturer of this CACNB4 antibody (ARP36763_P050)

Click here to view the CACNB4 antibody Western Blot Protocol

Product Datasheet Link: CACNB4 antibody (ARP36763_P050)

WB Suggested Anti-CACNB4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7

Western Blot image:


Description of Target: CACNB4 is a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME).

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CACNB4 antibody (ARP36763_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com