CACNA1G antibody - C - terminal region (ARP35566_P050)

Catalog#: ARP35566_P050

• Size: 50ug

Human Spleen

Human brain

• Description of Target: Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance. See MIM 601011. Low-voltage-activated calcium channels are referred to as 'T' type because their currents are both tra
• Gene Symbol: CACNA1G
• Official Gene Full Name: Calcium channel, voltage-dependent, T type, alpha 1G subunit
• Alias Symbols: Ca(V)T.1; Cav3.1; MGC117234; NBR13
• Protein Accession#: NP_938202
• Nucleotide Accession#: NM_198388
• Swissprot Id: O43497
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 2171
• Molecular Weight: 241kDa
• Application: WB, IHC
• Subunit: alpha-1G
• Partner Proteins: FXR2, KCTD4, FXR2, KCTD4
• Immunogen: The immunogen for anti-CACNA1G antibody: synthetic peptide directed towards the C terminal region of human CACNA1G
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Bovine: 92%; Guinea pig: 92%; Mouse: 92%; Pig: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS
• Blocking Peptide: For anti-CACNA1G antibody is Catalog # AAP35566 (Previous Catalog # AAPP06810)
• Key Reference: Ogino,S., (2007) J Mol Diagn 9 (3), 305-314
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-CACNA1G antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: CACNA1G antibody tested with Human Fetal Spleen Tissue (ARP35566_P050)

Aviva Systems Biology is the original manufacturer of this CACNA1G antibody (ARP35566_P050)

Click here to view the CACNA1G antibody Western Blot Protocol

Product Datasheet Link: CACNA1G antibody (ARP35566_P050)

WB Suggested Anti-CACNA1G Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Spleen

Western Blot image:


Description of Target: Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance. See MIM 601011. Low-voltage-activated calcium channels are referred to as 'T' type because their currents are both tra

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CACNA1G antibody (ARP35566_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com