SOCS7 antibody - N-terminal region (ARP53700_P050)

Catalog#: ARP53700_P050

• Size: 50ug

Human OVCAR-3

• Description of Target: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. SOCS7 functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. SOCS7 inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
• Gene Symbol: SOCS7
• Official Gene Full Name: Suppressor of cytokine signaling 7
• Alias Symbols: NAP4; NCKAP4
• Protein Accession#: NP_055413
• Nucleotide Accession#: NM_014598
• Swissprot Id: O14512
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 581
• Molecular Weight: 64kDa
• Application: WB
• Partner Proteins: APAF1, FAS, FEM1B, KIAA0319, COPS6
• Immunogen: The immunogen for anti-SOCS7 antibody: synthetic peptide directed towards the N terminal of human SOCS7
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP
• Blocking Peptide: For anti-SOCS7 antibody is Catalog # AAP53700 (Previous Catalog # AAPP30542)
• Key Reference: Kremer,B.E., (2007) Cell 130 (5), 837-850
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-SOCS7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: SOCS7 antibody tested with Human Ovcar-3 Cells (ARP53700_P050)

Aviva Systems Biology is the original manufacturer of this SOCS7 antibody (ARP53700_P050)

Click here to view the SOCS7 antibody Western Blot Protocol

Product Datasheet Link: SOCS7 antibody (ARP53700_P050)

WB Suggested Anti-SOCS7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3

Western Blot image:


Description of Target: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. SOCS7 functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. SOCS7 inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SOCS7 antibody (ARP53700_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com