- Description of Target:
- IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B.The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Gene Symbol:
- IL28RA
- Official Gene Full Name:
- Interleukin 28 receptor, alpha (interferon, lambda receptor)
- Alias Symbols:
- CRF2/12; IFNLR; IFNLR1; LICR2; il-28r1; IL-28R1
- Tissue Tool:
- Find tissues and cell lines supported to express IL28RA.
- Protein Accession# :
- NP_734464
- Nucleotide Accession#:
- NM_170743
- Swissprot Id:
- Q8IU57
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 520
- Molecular Weight:
- 58kDa
- Application:
- WB
- Subunit:
- alpha
- Partner Proteins:
- ASCC2, CD163, CXCR4, GRIN1, MEN1, MYBPC3, MYH10, MYL9, MYOM1, MYOM2, OVGP1, PTPN6, S100A4, TTN, TUFM, ASCC2, EPB41, MARK4, MYL9, PRKCE, USP1, USP45
- Immunogen:
- The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- IL28RA antibody - N-terminal region (ARP48070_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Dog: 86%; Horse: 86%; Rabbit: 85%; Bovine: 80%
- Datasheets / Downloads:
- Printable datasheet for
anti-IL28RA antibody
- ARP48070_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV
- Blocking Peptide:
- For anti-IL28RA antibody is Catalog # AAP48070 (Previous Catalog # AAPS21201)
- Key Reference:
- Dumoutier,L., (2004) J. Biol. Chem. 279 (31), 32269-32274
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-IL28RA antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: IL28RA antibody tested with Human Hepg2 Cells (ARP48070_P050)
Aviva Systems Biology is the original manufacturer of this IL28RA antibody (ARP48070_P050)
Click here to view the IL28RA antibody Western Blot Protocol
Product Datasheet Link: IL28RA antibody (ARP48070_P050)
WB Suggested Anti-IL28RA Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2
Western Blot image: 
Description of Target: IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B.The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s IL28RA antibody (ARP48070_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
