website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

IL13RA2 antibody - middle region (ARP53558_P050)

Description of Target:
IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
IL13RA2
Official Gene Full Name:
Interleukin 13 receptor, alpha 2
NCBI Gene Id:
3598
Alias Symbols:
CD213A2; IL-13R; IL13BP; CT19
Tissue Tool:
Find tissues and cell lines supported to express IL13RA2.
Protein Accession #:
NP_000631
Nucleotide Accession#:
NM_000640
Swissprot Id:
Q14627
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Interleukin-13 receptor subunit alpha-2
Protein Size (# AA):
380
Molecular Weight:
42kDa
Application:
WB
Subunit:
alpha-2
Immunogen:
The immunogen for anti-IL13RA2 antibody: synthetic peptide directed towards the middle region of human IL13RA2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
IL13RA2 antibody - middle region (ARP53558_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rat: 79%; Rabbit: 79%
Species Reactivity:
Human, Rabbit, Rat
Datasheets / Downloads:
Printable datasheet for
anti-IL13RA2 antibody
- ARP53558_P050
Peptide Sequence:
Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
Blocking Peptide:
For anti-IL13RA2 antibody is Catalog # AAP53558 (Previous Catalog # AAPS32710)
Key Reference:
Katsoulotos,G.P., (2008) J. Biol. Chem. 283 (3), 1610-1621
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-IL13RA2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question