website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/7/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

IL13RA2 antibody - middle region (ARP53558_P050)

Description of Target:
IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
IL13RA2
Official Gene Full Name:
Interleukin 13 receptor, alpha 2
NCBI Gene Id:
3598
Alias Symbols:
CD213A2; IL-13R; IL13BP; CT19
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IL13RA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IL13RA2.
Swissprot Id:
Q14627
Protein Accession #:
NP_000631
Nucleotide Accession #:
NM_000640
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Interleukin-13 receptor subunit alpha-2
Protein Size (# AA):
380
Molecular Weight:
42kDa
Application:
WB
Subunit:
alpha-2
Protein Interactions:
UBC; IL4; IL13;
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human IL13RA2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-IL13RA2 (ARP53558_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rabbit: 79%; Rat: 79%
Species Reactivity:
Human; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-IL13RA2 (ARP53558_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
Blocking Peptide:
For anti-IL13RA2 (ARP53558_P050) antibody is Catalog # AAP53558 (Previous Catalog # AAPS32710)
Target Reference:
Katsoulotos,G.P., (2008) J. Biol. Chem. 283 (3), 1610-1621
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: IL13RA2 antibody tested with Human Hepg2 Cells (ARP53558_P050)

Aviva Systems Biology is the original manufacturer of this IL13RA2 antibody (ARP53558_P050)

Click here to view the IL13RA2 antibody Western Blot Protocol

Product Datasheet Link: IL13RA2 antibody (ARP53558_P050)

WB Suggested Anti-IL13RA2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s IL13RA2 antibody (ARP53558_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question