IL13RA2 antibody - middle region (ARP53558_P050)

Catalog#: ARP53558_P050

• Size: 50ug

Human HepG2

• Description of Target: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: IL13RA2
• Official Gene Full Name: Interleukin 13 receptor, alpha 2
• Alias Symbols: CD213A2; IL-13R; IL13BP; CT19
• Protein Accession#: NP_000631
• Nucleotide Accession#: NM_000640
• Swissprot Id: Q14627
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 380
• Molecular Weight: 42kDa
• Application: WB
• Subunit: alpha-2
• Immunogen: The immunogen for anti-IL13RA2 antibody: synthetic peptide directed towards the middle region of human IL13RA2
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 78%
• Peptide Sequence: Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
• Blocking Peptide: For anti-IL13RA2 antibody is Catalog # AAP53558 (Previous Catalog # AAPS32710)
• Key Reference: Katsoulotos,G.P., (2008) J. Biol. Chem. 283 (3), 1610-1621
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-IL13RA2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: IL13RA2 antibody tested with Human Hepg2 Cells (ARP53558_P050)

Aviva Systems Biology is the original manufacturer of this IL13RA2 antibody (ARP53558_P050)

Click here to view the IL13RA2 antibody Western Blot Protocol

Product Datasheet Link: IL13RA2 antibody (ARP53558_P050)

WB Suggested Anti-IL13RA2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s IL13RA2 antibody (ARP53558_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com