website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

IL13RA2 antibody - middle region (ARP53558_P050)

Description of Target:
IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
IL13RA2
Official Gene Full Name:
Interleukin 13 receptor, alpha 2
NCBI Gene Id:
3598
Alias Symbols:
CD213A2; IL-13R; IL13BP; CT19
Tissue Tool:
Find tissues and cell lines supported to express IL13RA2.
Protein Accession #:
NP_000631
Nucleotide Accession#:
NM_000640
Swissprot Id:
Q14627
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Interleukin-13 receptor subunit alpha-2
Protein Size (# AA):
380
Molecular Weight:
42kDa
Application:
WB
Subunit:
alpha-2
Immunogen:
The immunogen for anti-IL13RA2 antibody: synthetic peptide directed towards the middle region of human IL13RA2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
IL13RA2 antibody - middle region (ARP53558_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rat: 79%; Rabbit: 79%
Species Reactivity:
Human, Rabbit, Rat
Datasheets / Downloads:
Printable datasheet for
anti-IL13RA2 antibody
- ARP53558_P050
Peptide Sequence:
Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
Blocking Peptide:
For anti-IL13RA2 antibody is Catalog # AAP53558 (Previous Catalog # AAPS32710)
Target Reference:
Katsoulotos,G.P., (2008) J. Biol. Chem. 283 (3), 1610-1621
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-IL13RA2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for IL13RA2 antibody (ARP53558)

Product page for IL13RA2 antibody (ARP53558)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Human I13R2 antibody; Homo sapiens I13R2 antibody Q14627 100%
Human IL13RA2 antibody; Homo sapiens IL13RA2 antibody D0EFR8 100%
Lowland gorilla IL13RA2 antibody; Gorilla gorilla gorilla IL13RA2 antibody G3R8Y4 100%
Northern white-cheeked gibbon IL13RA2 antibody; Nomascus leucogenys IL13RA2 antibody G1RX47 92%
Rabbit IL13RA2 antibody; Oryctolagus cuniculus IL13RA2 antibody G1T812 78%
Rhesus macaque IL13RA2 antibody; Macaca mulatta IL13RA2 antibody F6Z890 92%
White-tufted-ear marmoset LOC100387833 antibody; Callithrix jacchus LOC100387833 antibody F6T9T2 78%

Product Protocols: IL13RA2 antibody tested with Human Hepg2 Cells (ARP53558_P050)

Aviva Systems Biology is the original manufacturer of this IL13RA2 antibody (ARP53558_P050)

Click here to view the IL13RA2 antibody Western Blot Protocol

Product Datasheet Link: IL13RA2 antibody (ARP53558_P050)

WB Suggested Anti-IL13RA2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s IL13RA2 antibody (ARP53558_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question