Catalog No: ARP59177_P050
Price: $0.00
SKU
ARP59177_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CSTB (ARP59177_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Rat, Cow, Horse, Pig, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CSTB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Horse: 93%; Human: 100%; Pig: 92%; Rat: 75%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: ADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRV
Concentration0.5 mg/ml
Blocking PeptideFor anti-CSTB (ARP59177_P050) antibody is Catalog # AAP59177 (Previous Catalog # AAPP45145)
Gene SymbolCSTB
Gene Full NameCystatin B (stefin B)
Alias SymbolsPME, ULD, CST6, EPM1, STFB, CPI-B, EPM1A
NCBI Gene Id1476
Protein NameCystatin-B
Description of TargetCSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy.
Uniprot IDP04080
Protein Accession #NP_000091
Nucleotide Accession #NM_000100
Protein Size (# AA)98
Molecular Weight11kDa
Protein InteractionsUBC; SARNP; DPP7; BAG3; CFTR; ECT2; SEC24A; NUDC; MAT2A; FLNB; DCUN1D1; CUL3; RAD21; SPRY2; CTSL; CTSD; CTSH; CTSB; CST3; VHL;
  1. What is the species homology for "CSTB Antibody - N-terminal region (ARP59177_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Rat, Cow, Horse, Pig, Sheep".

  2. How long will it take to receive "CSTB Antibody - N-terminal region (ARP59177_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CSTB Antibody - N-terminal region (ARP59177_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CSTB Antibody - N-terminal region (ARP59177_P050)"?

    This target may also be called "PME, ULD, CST6, EPM1, STFB, CPI-B, EPM1A" in publications.

  5. What is the shipping cost for "CSTB Antibody - N-terminal region (ARP59177_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CSTB Antibody - N-terminal region (ARP59177_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CSTB Antibody - N-terminal region (ARP59177_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "11kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CSTB Antibody - N-terminal region (ARP59177_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CSTB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CSTB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CSTB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CSTB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CSTB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CSTB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CSTB Antibody - N-terminal region (ARP59177_P050)
Your Rating
We found other products you might like!