website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RBM10 antibody - N-terminal region (ARP30104_T100)

Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
In Stock

Conjugation Options

ARP30104_T100-FITC Conjugated

ARP30104_T100-HRP Conjugated

ARP30104_T100-Biotin Conjugated

Free trial-size samples may be available for this item. Please go here for more information.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
RNA binding motif protein 10
Protein Name:
RNA-binding protein 10
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-515548 from Santa Cruz Biotechnology.
Description of Target:
RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RBM10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RBM10.
The immunogen is a synthetic peptide directed towards the N terminal region of human RBM10
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-RBM10 (ARP30104_T100)
Peptide Sequence:
Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RBM10 (ARP30104_T100) antibody is Catalog # AAP30104 (Previous Catalog # AAPH00280)
Datasheets / Downloads:
Printable datasheet for anti-RBM10 (ARP30104_T100) antibody
Sample Type Confirmation:

RBM10 is strongly supported by BioGPS gene expression data to be expressed in Daudi

Target Reference:
Thiselton,D.L., et al., (2002) Genomics 79 (4), 560-572

Product Protocols: RBM10 antibody tested with Human Daudi Cells (ARP30104_T100)

Aviva Systems Biology is the original manufacturer of this RBM10 antibody (ARP30104_T100)

Click here to view the RBM10 antibody Western Blot Protocol

Product Datasheet Link: RBM10 antibody (ARP30104_T100)

WB Suggested Anti-RBM10 Antibody Titration: 1.4ug/ml
ELISA Titer: 1:1562500
Positive Control: Daudi

Western Blot image:

Description of Target: RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s RBM10 antibody (ARP30104_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: RBM10 antibody tested by IHC with human lung (ARP30104)

Aviva Systems Biology is the original manufacturer of this RBM10 antibody.

Click here to view the RBM10 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: RBM10 antibody (ARP30104)

IHC Information:

Rabbit Anti-RBM10 Antibody
Catalog Number: ARP30104
Paraffin Embedded Tissue: Human Lung
Cellular Data: Epithelial cells of bronchiole
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: RBM10 antibody tested by IHC with human heart (ARP30104)

Aviva Systems Biology is the original manufacturer of this RBM10 antibody.

Click here to view the RBM10 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: RBM10 antibody (ARP30104)

IHC Information:

Rabbit Anti-RBM10 Antibody
Catalog Number: ARP30104
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question