website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/5/2016.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MYC antibody - N-terminal region (ARP32708_P050)

  • Catalog#: ARP32708_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    In Stock

    Conjugation Options

    ARP32708_P050-FITC Conjugated

    ARP32708_P050-HRP Conjugated

    ARP32708_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    V-myc myelocytomatosis viral oncogene homolog (avian)
    Protein Name:
    Myc proto-oncogene protein
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    c-Myc, MRTL, bHLHe39
    Replacement Item:
    This antibody may replace item sc-110502 from Santa Cruz Biotechnology.
    Description of Target:
    MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express MYC.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express MYC.
    The immunogen is a synthetic peptide directed towards the N terminal region of human MYC
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
    Predicted Homology Based on Immunogen Sequence:
    Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
    Complete computational species homology data:
    Anti-MYC (ARP32708_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-MYC (ARP32708_P050) antibody is Catalog # AAP32708 (Previous Catalog # AAPP03722)
    Datasheets / Downloads:
    Printable datasheet for anti-MYC (ARP32708_P050) antibody
    Target Reference:
    Frater,J.L., (2006) Cancer Genet. Cytogenet. 166 (2), 139-145

    Product Protocols: MYC antibody tested with Human Transfected 293T Cells (ARP32708_P050)

    Aviva Systems Biology is the original manufacturer of this MYC antibody (ARP32708_P050)

    Click here to view the MYC antibody Western Blot Protocol

    Product Datasheet Link: MYC antibody (ARP32708_P050)

    WB Suggested Anti-MYC Antibody Titration: 0.0625ug/ml
    Positive Control: Transfected 293T

    Western Blot image:

    Description of Target: MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s MYC antibody (ARP32708_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Product Protocols: MYC antibody tested by IHC with human muscle (ARP32708)

    Aviva Systems Biology is the original manufacturer of this MYC antibody.

    Click here to view the MYC antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: MYC antibody (ARP32708)

    IHC Information:

    Rabbit Anti-MYC Antibody
    Catalog Number: ARP32708
    Paraffin Embedded Tissue: Human Muscle
    Cellular Data: Skeletal muscle cells
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

    Ask a Question