website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/30/2016.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

US

MYC antibody - N-terminal region (ARP32708_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    MYC
    NCBI Gene Id:
    4609
    Official Gene Full Name:
    V-myc myelocytomatosis viral oncogene homolog (avian)
    Protein Name:
    Myc proto-oncogene protein
    Swissprot Id:
    P01106
    Protein Accession #:
    NP_002458
    Nucleotide Accession #:
    NM_002467
    Alias Symbols:
    c-Myc, MRTL, bHLHe39
    Description of Target:
    MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.
    Protein Size (# AA):
    454
    Molecular Weight:
    50kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express MYC.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express MYC.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the N terminal region of human MYC
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
    Predicted Homology Based on Immunogen Sequence:
    Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
    Complete computational species homology data:
    Anti-MYC (ARP32708_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; USP37; USP22; KDM1A; SKP2; SMAD7; SNRNP70; CEP57; LDOC1; BRD3; KIDINS220; MAX; CSNK2B; CSNK2A1; USP28; NMI; PFDN5; TP73; EP400; SP1; PIAS2; ZBTB17; IGF2BP3; PTRF; SDK1; MRPL53; PRKCDBP; PHLDB2; KNDC1; MZT2B; RIN3; NEK11; MICALL2; NLRX1; NABP2; MYC; M
    Blocking Peptide:
    For anti-MYC (ARP32708_P050) antibody is Catalog # AAP32708 (Previous Catalog # AAPP03722)
    Datasheets / Downloads:
    Printable datasheet for anti-MYC (ARP32708_P050) antibody
    Target Reference:
    Frater,J.L., (2006) Cancer Genet. Cytogenet. 166 (2), 139-145

    Product Protocols: MYC antibody tested with Human Transfected 293T Cells (ARP32708_P050)

    Aviva Systems Biology is the original manufacturer of this MYC antibody (ARP32708_P050)

    Click here to view the MYC antibody Western Blot Protocol

    Product Datasheet Link: MYC antibody (ARP32708_P050)

    WB Suggested Anti-MYC Antibody Titration: 0.0625ug/ml
    Positive Control: Transfected 293T

    Western Blot image:


    Description of Target: MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s MYC antibody (ARP32708_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

    Product Protocols: MYC antibody tested by IHC with human muscle (ARP32708)

    Aviva Systems Biology is the original manufacturer of this MYC antibody.

    Click here to view the MYC antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: MYC antibody (ARP32708)

    IHC Information:

    Rabbit Anti-MYC Antibody
    Catalog Number: ARP32708
    Paraffin Embedded Tissue: Human Muscle
    Cellular Data: Skeletal muscle cells
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

     
    X
    Ask a Question