website statistics

Aviva Systems Biology

Account Login 

Aviva Systems Biology office will be closed on Memorial Day - 5/27/2013.
Please go here for more info.

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
100ug
$229.00
In Stock

CLDN9 antibody - C-terminal region (ARP33617_T100)

Description of Target:
CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Gene Symbol:
CLDN9
Official Gene Full Name:
Claudin 9
Tissue Tool:
Find tissues and cell lines supported to express CLDN9.
Protein Accession# :
NP_066192
Nucleotide Accession#:
NM_020982
Swissprot Id:
O95484
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
217
Molecular Weight:
24kDa
Application:
WB
Immunogen:
The immunogen for anti-CLDN9 antibody: synthetic peptide directed towards the C terminal of human CLDN9
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
CLDN9 antibody - C-terminal region (ARP33617_T100)
Predicted Homology Based on Immunogen Sequence:
Bovine: 100%; Dog: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Datasheets / Downloads:
Printable datasheet for
anti-CLDN9 antibody
- ARP33617_T100
Peptide Sequence:
Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
Blocking Peptide:
For anti-CLDN9 antibody is Catalog # AAP33617 (Previous Catalog # AAPP04673)
Key Reference:
Katoh,M. and Katoh,M., (2003) Int. J. Mol. Med. 11 (6), 683-689
Reconstitution and Storage:
Add 100 μl of distilled water. Final anti-CLDN9 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: SDS-PAGE and immunoblotting Protocol with CLDN9 Antibody (Catalog Number: ARP33617_T100)

Product Protocols:
SDS-PAGE and immunoblotting Protocol with Gene Name: CLDN9 Antibody (Catalog Number: ARP33617_T100)

Catalog Number: ARP33617_T100

Citation:
1. Abuazza G, Becker A, Williams SS, Chakravarty S, Truong HT, Lin F, Baum M. Claudins 6, 9, and 13 are developmentally expressed renal tight junction proteins. Am J Physiol Renal Physiol. 2006 Dec,291(6):F1132-41. Epub 2006 Jun 13.
PubMed PMID: 16774906.
Product Name: CLDN9 antibody - C-terminal region (ARP33617_T100)

Gene Name: CLDN9

Species: Mouse

Experiment Name: SDS-PAGE and immunoblotting

Experiment Background:
1. To determine whether there are developmental claudin isoforms, Ghazala et al. compared the claudin isoforms present in the neonatal and adult kidney using RT-PCR to detect mRNA of claudin isoforms. Claudin 6, claudin 9, and claudin 13 were either not expressed or barely detectable in the adult mouse kidney using traditional PCR, but were expressed in the neonatal mouse kidney.
2. Using real-time RT-PCR, we were able to detect a low level of claudin 6 mRNA expression in the adult kidney compared with the neonate, but claudin 9 and claudin 13 were only detected in the neonatalkidney. There was the same maturational decrease in these claudin proteins with Western blot analysis.
3. Claudin 9 was only consistently detectable in proximal convoluted tubules of 1-day-old neonates and only after more than 35 cycles of amplification. Claudin 13 was not detectable. It is possible that claudin 9 and 13 play a role in determining neonatal paracellular permeability in a distal nephron segment.

Experimental Steps:
1. Neonatal and adult kidney protein (100 ug/lane) were denatured and separated on a 6% polyacrylamide gel using SDS-PAGE.
2. The proteins were transferred overnight to a polyvinylidene diflouride membrane at 120-140 mA at 4 C.
3. The blot was blocked with fresh Blotto (5% nonfat milk and 0.1% Tween 20 in PBS, pH 7.4) for 1 h followed by incubation with overnight at 4 C with a primary antibody to mouse claudin 6 (Orbigen, San Diego, CA) at a 1:5,000 dilution, claudin 9 (Aviva Systems Biology, San Diego, CA) at 1:1,000 dilution or claudin 13 (Zymed Laboratories, South San Francisco, CA) at 1:100 dilution.
4. The blot was then washed extensively with Blotto.
5. The secondary antibody, horseradish peroxidase-conjugated donkey anti-rabbit immunoglobulin, was added at 1:10,000 dilution and incubated at room temperature for 1 h.
6. The blot was again washed with Blotto, and enhanced chemiluminescence was used to detect boundantibody (Amersham Biosciences, Piscataway, NJ). Claudin 6, 9, and 13 protein abundance was quantitated using densitometry.
7. Equal loading of samples was confirmed using an antibody to -actin at 1:5,000 dilution (Sigma Biochemicals, St. Louis, MO). There were at least six samples in each group.

Product Protocols: CLDN9 antibody tested with Human Hepg2 Cells (ARP33617_T100)

Aviva Systems Biology is the original manufacturer of this CLDN9 antibody (ARP33617_T100)

Click here to view the CLDN9 antibody Western Blot Protocol

Product Datasheet Link: CLDN9 antibody (ARP33617_T100)

WB Suggested Anti-CLDN9 Antibody Titration: 2.0ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CLDN9 antibody (ARP33617_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com