- Description of Target:
- CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
- Gene Symbol:
- CLDN8
- Official Gene Full Name:
- Claudin 8
- Tissue Tool:
- Find tissues and cell lines supported to express CLDN8.

- Protein Accession# :
- NP_955360
- Nucleotide Accession#:
- NM_199328
- Swissprot Id:
- P56748
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 225
- Molecular Weight:
- 25kDa
- Application:
- WB, IHC
- Partner Proteins:
- BRD4, CLDN1, CLDN3, INADL, MMP14, MMP2, MPDZ, TJP1, TJP2, TJP3, WNK4, CLDN3, CLDN5, INADL, TJP1, TJP2, TJP3
- Immunogen:
- The immunogen for anti-CLDN8 antibody: synthetic peptide directed towards the C terminal of human CLDN8
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- CLDN8 antibody - C-terminal region (ARP33621_T100)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Bovine: 84%
- Datasheets / Downloads:
- Printable datasheet for
anti-CLDN8 antibody
- ARP33621_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
- Blocking Peptide:
- For anti-CLDN8 antibody is Catalog # AAP33621 (Previous Catalog # AAPP04677)
- Key Reference:
- Clark,H.F.,et al., (2003) Genome Res.13(10),2265-2270
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-CLDN8 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: CLDN8 antibody tested with Human Hepg2 Cells (ARP33621_T100)
Aviva Systems Biology is the original manufacturer of this CLDN8 antibody (ARP33621_T100)
Click here to view the CLDN8 antibody Western Blot Protocol
Product Datasheet Link: CLDN8 antibody (ARP33621_T100)
WB Suggested Anti-CLDN8 Antibody Titration: 0.5-1.0ug/ml
Positive Control: HepG2
Western Blot image: 
Description of Target: CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s CLDN8 antibody (ARP33621_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: CLDN8 antibody tested by IHC with human intestine (ARP33621)
Aviva Systems Biology is the original manufacturer of this CLDN8 antibody.
Click here to view the CLDN8 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: CLDN8 antibody (ARP33621)
IHC Information:
Rabbit Anti-CLDN8 Antibody
Catalog Number: ARP33621
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
Product Protocols: CLDN8 antibody tested by IHC with human kidney (ARP33621)
Aviva Systems Biology is the original manufacturer of this CLDN8 antibody.
Click here to view the CLDN8 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: CLDN8 antibody (ARP33621)
IHC Information:
Rabbit Anti-CLDN8 Antibody
Catalog Number: ARP33621
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 200X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.


