CLDN5 antibody - C-terminal region (ARP33627_P050)

Catalog#: ARP33627_P050

• Size: 50ug

Transfected 293T

• Description of Target: CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: CLDN5
• Official Gene Full Name: Claudin 5
• Alias Symbols: AWAL; BEC1; CPETRL1; TMVCF
• Protein Accession#: NP_003268
• Nucleotide Accession#: NM_003277
• Swissprot Id: O00501
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 218
• Molecular Weight: 23kDa
• Application: WB
• Partner Proteins: TSPAN3, TSPAN4
• Immunogen: The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Human: 100%; Pig: 100%; African clawed frog: 78%; Chicken: 78%
• Peptide Sequence: Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN
• Blocking Peptide: For anti-CLDN5 antibody is Catalog # AAP33627 (Previous Catalog # AAPP04683)
• Key Reference: Fontijn,R.D., Am. J. Physiol. Heart Circ. Physiol. 294 (2), H891-H900 (2008)
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-CLDN5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: CLDN5 antibody tested with Human Transfected 293T Cells (ARP33627_P050)

Aviva Systems Biology is the original manufacturer of this CLDN5 antibody (ARP33627_P050)

Click here to view the CLDN5 antibody Western Blot Protocol

Product Datasheet Link: CLDN5 antibody (ARP33627_P050)

WB Suggested Anti-CLDN5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Western Blot image:


Description of Target: CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CLDN5 antibody (ARP33627_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com