website statistics

Aviva Systems Biology

Account Login 

Aviva Systems Biology office will be closed on Memorial Day - 5/27/2013.
Please go here for more info.

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
100ug
$229.00
In Stock

CLDN17 antibody - middle region (ARP33615_T100)

Description of Target:
CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Gene Symbol:
CLDN17
Official Gene Full Name:
Claudin 17
Tissue Tool:
Find tissues and cell lines supported to express CLDN17.
Protein Accession# :
NP_036263
Nucleotide Accession#:
NM_012131
Swissprot Id:
P56750
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
224
Molecular Weight:
25kDa
Application:
WB, IHC
Immunogen:
The immunogen for anti-CLDN17 antibody: synthetic peptide directed towards the middle region of human CLDN17
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
CLDN17 antibody - middle region (ARP33615_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Bovine: 84%; Sheep: 84%
Datasheets / Downloads:
Printable datasheet for
anti-CLDN17 antibody
- ARP33615_T100
Peptide Sequence:
Synthetic peptide located within the following region: KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
Blocking Peptide:
For anti-CLDN17 antibody is Catalog # AAP33615 (Previous Catalog # AAPP04671)
Key Reference:
Katoh,M. and Katoh,M. (2003) Int. J. Mol. Med. 11 (6), 683-689
Reconstitution and Storage:
Add 100 μl of distilled water. Final anti-CLDN17 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: CLDN17 antibody tested with Human Jurkat Cells (ARP33615_T100)

Aviva Systems Biology is the original manufacturer of this CLDN17 antibody (ARP33615_T100)

Click here to view the CLDN17 antibody Western Blot Protocol

Product Datasheet Link: CLDN17 antibody (ARP33615_T100)

WB Suggested Anti-CLDN17 Antibody Titration: 2.0ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CLDN17 antibody (ARP33615_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: CLDN17 antibody tested by IHC with human lung (ARP33615)

Aviva Systems Biology is the original manufacturer of this CLDN17 antibody.

Click here to view the CLDN17 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: CLDN17 antibody (ARP33615)

IHC Information:

Rabbit Anti-CLDN17 Antibody
Catalog Number: ARP33615
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: CLDN17 antibody tested by IHC with human spleen (ARP33615)

Aviva Systems Biology is the original manufacturer of this CLDN17 antibody.

Click here to view the CLDN17 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: CLDN17 antibody (ARP33615)

IHC Information:

Rabbit Anti-CLDN17 Antibody
Catalog Number: ARP33615
Paraffin Embedded Tissue: Human Spleen
Cellular Data: Spleen cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: