- Description of Target:
- CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.The protein encoded by this gene belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.
- Gene Symbol:
- CLDN11
- Official Gene Full Name:
- Claudin 11
- Alias Symbols:
- OSP; OTM
- Tissue Tool:
- Find tissues and cell lines supported to express CLDN11.
- Protein Accession# :
- NP_005593
- Nucleotide Accession#:
- NM_005602
- Swissprot Id:
- O75508
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 207
- Molecular Weight:
- 22kDa
- Application:
- WB, IHC
- Partner Proteins:
- TJP1
- Immunogen:
- The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- CLDN11 antibody - C-terminal region (ARP33628_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 100%; Pig: 100%; Chicken: 85%; Rat: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-CLDN11 antibody
- ARP33628_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
- Blocking Peptide:
- For anti-CLDN11 antibody is Catalog # AAP33628 (Previous Catalog # AAPP04684)
- Key Reference:
- Hosokawa,M., (2003) Glia 42 (4), 417-423
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-CLDN11 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: CLDN11 antibody tested with Human Transfected 293T Cells (ARP33628_P050)
Aviva Systems Biology is the original manufacturer of this CLDN11 antibody (ARP33628_P050)
Click here to view the CLDN11 antibody Western Blot Protocol
Product Datasheet Link: CLDN11 antibody (ARP33628_P050)
WB Suggested Anti-CLDN11 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
Western Blot image: 
Description of Target: CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.The protein encoded by this gene belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s CLDN11 antibody (ARP33628_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: CLDN11 antibody tested by IHC with human muscle (ARP33628)
Aviva Systems Biology is the original manufacturer of this CLDN11 antibody.
Click here to view the CLDN11 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: CLDN11 antibody (ARP33628)
IHC Information:
Rabbit Anti-CLDN11 Antibody
Catalog Number: ARP33628
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
