PTHLH Antibody - middle region (ARP33885_T100)

Catalog No: ARP33885_T100

WB Suggested Anti-PTHLH Antibody Titration: 2.0ug/ml
Positive Control: HepG2 cell lysate

Primary antibody dilution: 1:1000
Secondary antibody: Goat anti-rabbit HRP
Secondary antibody dilution:1:2000

Rabbit Anti-PTHLH Antibody
Catalog Number: ARP33885
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of collecting tubule and renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Information:Rabbit Anti-PTHLH Antibody
Catalog Number: ARP33885
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTHLH
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-PTHLH (ARP33885_T100) antibody is Catalog # AAP33885 (Previous Catalog # AAPP04956)
• Reference: Chen,C., et al., (2004) J. Biol. Chem. 279 (28), 29121-29129
• Publications:

  Müller, M., Gagiannis, S., Nawroth, P. P., Brune, M. & Schilling, T. Activation of the receptor for parathyroid hormone and parathyroid hormone related protein induces apoptosis via the extrinsic and intrinsic signaling pathway. Int. J. Mol. Med. 24, 373-80 (2009). 19639230

  Role of the Parathyroid Hormone Type 1 Receptor (PTH1R) as a Mechanosensor in Osteocyte Survival. J Bone Miner Res. 30, 1231-44 (2015). 25529820

  Zhao, C.-M. et al. Gene expression profiling of gastric mucosa in mice lacking CCK and gastrin receptors. Regul. Pept. 192-193C, 35-44 (2014). 25160855

• Description:
  View product citations for PTHLH Antibody - middle region (ARP33885_T100) on CiteAb

Target Info

• Gene Symbol: PTHLH
• Gene Full Name: Parathyroid hormone-like hormone
• Alias Symbols: HHM, PLP, BDE2, PTHR, PTHRP
• NCBI Gene Id: 5744
• Protein Name: Parathyroid hormone-related protein
• Description of Target: PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.
• Uniprot ID: P12272
• Protein Accession #: NP_002811
• Nucleotide Accession #: NM_002820
• Protein Size (# AA): 175
• Molecular Weight: 20kDa
• Protein Interactions: ELAVL1; PLK1; KPNB1; KLK3; PTH1R; IL6; CDK2; ARRB1;