ZNF335 Antibody - middle region (ARP39540_P050)

Catalog No: ARP39540_P050

WB Suggested Anti-ZNF335 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF335
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: EAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQLQHQGIEYDVITLAD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZNF335 (ARP39540_P050) antibody is Catalog # AAP39540 (Previous Catalog # AAPP21554)
• Reference: Garapaty,S., (2008) J. Biol. Chem. 283 (11), 6806-6816

Target Info

• Gene Symbol: ZNF335
• Gene Full Name: Zinc finger protein 335
• Alias Symbols: NIF1, NIF2, NIF-1, MCPH10
• NCBI Gene Id: 63925
• Protein Name: Zinc finger protein 335
• Description of Target: ZNF335 enhances transcriptional activation by ligand-bound nuclear hormone receptors. However, it does this not by direct interaction with the receptor, but by direct interaction with the nuclear hormone receptor transcriptional coactivator NRC. ZNF335 may function by altering local chromatin structure.The protein encoded by this gene enhances transcriptional activation by ligand-bound nuclear hormone receptors. However, it does this not by direct interaction with the receptor, but by direct interaction with the nuclear hormone receptor transcriptional coactivator NRC. The encoded protein may function by altering local chromatin structure.
• Uniprot ID: Q9H4Z2
• Protein Accession #: NP_071378
• Nucleotide Accession #: NM_022095
• Protein Size (# AA): 1342
• Molecular Weight: 145kDa
• Protein Interactions: CDK6; CDK4; TFAP4; CCAR2; C11orf30; WDR5; ASH2L; RBBP5; HCFC1; NCOA6;