TRDMT1 Antibody - N-terminal region (ARP48627_P050)

Catalog No: ARP48627_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-TRDMT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRDMT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRDMT1 (ARP48627_P050) antibody is Catalog # AAP48627 (Previous Catalog # AAPY01594)
• Reference: Matakidou,A., (2007) Br. J. Cancer 97 (2), 247-252

Target Info

• Gene Symbol: TRDMT1
• Gene Full Name: TRNA aspartic acid methyltransferase 1
• Alias Symbols: DMNT2, DNMT2, PUMET, RNMT1, MHSAIIP
• NCBI Gene Id: 1787
• Protein Name: tRNA (cytosine(38)-C(5))-methyltransferase
• Description of Target: CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. TRDMT1 is a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity. The protein strongly binds DNA, suggesting that it may mark specific sequences in the genome.CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity. The protein strongly binds DNA, suggesting that it may mark specific sequences in the genome. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Uniprot ID: O14717
• Protein Accession #: NP_004403
• Nucleotide Accession #: NM_004412
• Protein Size (# AA): 391
• Molecular Weight: 45 kDa
• Protein Interactions: TBC1D2B; SNRPD3; NFRKB; GBE1; APP; LRIF1; COPS6; RBM48; SETDB1; UTP14A; DDX24; UNC119; STX1A; EEF1A1;