SUPT6H Antibody - N-terminal region (ARP33387_P050)

Catalog No: ARP33387_P050

WB Suggested Anti-SUPT6H Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysateSUPT6H is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Mouse, Rat, Cow, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SUPT6H
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EGSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SUPT6H (ARP33387_P050) antibody is Catalog # AAP33387 (Previous Catalog # AAPP04433)
• Sample Type Confirmation:

  SUPT6H is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: SUPT6H
• Gene Full Name: Suppressor of Ty 6 homolog (S. cerevisiae)
• Alias Symbols: SPT6, SPT6H, emb-5
• NCBI Gene Id: 6830
• Protein Name: Transcription elongation factor SPT6
• Description of Target: SUPT6H may be functionally analogous to SPT6 and emb-5 and may therefore regulate transcription through establishment or maintenance of chromatin structure. Spt6 may also participates in the regulation of transcription by RNA polymerase II (RNAPII). Human Spt6 (hSpt6) is a classic transcription elongation factor that enhances the rate of RNAPII elongation. HSpt6 is capable of stimulating transcription elongation both individually and in concert with DRB sensitivity-inducing factor (DSIF).
• Uniprot ID: Q7KZ85
• Protein Accession #: NP_003161
• Nucleotide Accession #: NM_003170
• Protein Size (# AA): 1726
• Molecular Weight: 199kDa
• Protein Interactions: CEP76; HAUS2; CEP250; TUBGCP3; CEP57; VCP; TUBG1; TP53; EMD; CDKN1A; UBC; EED; BMI1; POLR2C; ERBB2; CSNK2A1; BRCA1; MDC1; PAAF1; SIRT7; SUMO2; POLR2A; IWS1; WDR48; TCEA1;