SSRP1 antibody - middle region (ARP31141_P050)

Catalog#: ARP31141_P050

• Size: 50ug

Human OVCAR-3

• Description of Target: SSRP1 is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. SSRP1 contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. It also functions as a co-activator of the transcriptional activator p63. The protein encoded by this gene is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. This encoded protein contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. This protein also functions as a co-activator of the transcriptional activator p63. An alternatively spliced transcript variant of this gene has been described, but its full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: SSRP1
• Official Gene Full Name: Structure specific recognition protein 1
• Alias Symbols: FACT; FACT80; T160
• Protein Accession#: NP_003137
• Nucleotide Accession#: NM_003146
• Swissprot Id: Q08945
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 709
• Molecular Weight: 81kDa
• Application: WB
• Subunit: SSRP1
• Partner Proteins: ACR, ARHGAP11A, BARD1, BIRC5, BRCA1, BTRC, C21orf32, CBX5, CCDC76, CCNA2, CCNA2, CDC25A, CDC6, CDK1, CDK1, CDK1, CHEK1, CSDA, CSTF3, CYP27B1, DBF4B, E2F1, E2F2, FHL2, FLJ20712, GAS2L1, HIST1H2AG, HIST1H2BJ, HIST2H4A, HOXA3, JMY, JPH2, LMO7, MAD2L1, MAP3K7, METAP2, MFAP1, MGC45922, MLH1, MSH2, M
• Immunogen: The immunogen for anti-SSRP1 antibody: synthetic peptide directed towards the middle region of human SSRP1
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 100%; Human: 100%; Bovine: 92%; Mouse: 92%; Rat: 92%; Guinea pig: 78%
• Peptide Sequence: Synthetic peptide located within the following region: SSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMS
• Blocking Peptide: For anti-SSRP1 antibody is Catalog # AAP31141 (Previous Catalog # AAPP24036)
• Key Reference: Li,Y., (2007) J. Biol. Chem. 282 (10), 6936-6945
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-SSRP1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: SSRP1 antibody tested with Human Ovcar-3 Cells (ARP31141_P050)

Aviva Systems Biology is the original manufacturer of this SSRP1 antibody (ARP31141_P050)

Click here to view the SSRP1 antibody Western Blot Protocol

Product Datasheet Link: SSRP1 antibody (ARP31141_P050)

WB Suggested Anti-SSRP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3

Western Blot image:


Description of Target: SSRP1 is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. SSRP1 contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. It also functions as a co-activator of the transcriptional activator p63. The protein encoded by this gene is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. This encoded protein contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. This protein also functions as a co-activator of the transcriptional activator p63. An alternatively spliced transcript variant of this gene has been described, but its full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SSRP1 antibody (ARP31141_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com