PPP4R1 Antibody - middle region (ARP62616_P050)

Catalog No: ARP62616_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: PPP4R1
Antibody Dilution: 1.0ug/ml
Sample Type: HT1080 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Horse: 100%; Human: 100%; Pig: 85%; Rabbit: 79%
• Peptide Sequence: Synthetic peptide located within the following region: EDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PPP4R1 (ARP62616_P050) antibody is Catalog # AAP62616
• Subunit: 1

Target Info

• Gene Symbol: PPP4R1
• Gene Full Name: Protein phosphatase 4, regulatory subunit 1
• Alias Symbols: MEG1, PP4R1, PP4(Rmeg)
• NCBI Gene Id: 9989
• Protein Name: Serine/threonine-protein phosphatase 4 regulatory subunit 1
• Description of Target: PPP4R1 is a regulatory subunit of serine/threonine-protein phosphatase 4. PPP4R1 may play a role in regulation of cell division in renal glomeruli. The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation and regulation of HDAC3.
• Uniprot ID: Q8TF05
• Protein Accession #: NP_001035847
• Nucleotide Accession #: NM_001042388
• Protein Size (# AA): 950
• Molecular Weight: 107kDa
• Protein Interactions: TRAF6; TRAF2; POLR2C; POLR2A; MAP4; MTA2; SPTAN1; EHBP1L1; GPHN; HNRNPR; UBC; CEP63; DISC1; PPP4C; HDAC3;