NCAPH Antibody - C-terminal region (ARP46227_P050)

Catalog No: ARP46227_P050

WB Suggested Anti-NCAPH Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateNCAPH is supported by BioGPS gene expression data to be expressed in HepG2

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NCAPH
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NCAPH (ARP46227_P050) antibody is Catalog # AAP46227 (Previous Catalog # AAPP27060)
• Sample Type Confirmation:

  NCAPH is supported by BioGPS gene expression data to be expressed in HepG2

• Subunit: 2
• Reference: Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292

Target Info

• Gene Symbol: NCAPH
• Gene Full Name: Non-SMC condensin I complex, subunit H
• Alias Symbols: CAPH, BRRN1, CAP-H, MCPH23
• NCBI Gene Id: 23397
• Protein Name: Condensin complex subunit 2
• Description of Target: NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.
• Uniprot ID: Q15003
• Protein Accession #: NP_056156
• Nucleotide Accession #: NM_015341
• Protein Size (# AA): 741
• Molecular Weight: 82kDa
• Protein Interactions: SUMO2; UBC; RNF2; HECTD3; NCAPG; ZZEF1; SMC2; SMC4; NCAPD2; GBF1; PLEC; LMNB1; VCP; CDK1; ark1; AURKB; HIST2H2AC; H2AFZ; tat; CAPG;