Catalog No: ARP40172_P050
Price: $0.00
SKU
ARP40172_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MBD1 (ARP40172_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MBD1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-MBD1 (ARP40172_P050) antibody is Catalog # AAP40172 (Previous Catalog # AAPP20915)
ReferenceWischnewski,F., (2007) Mol. Cancer Res. 5 (7), 749-759
Gene SymbolMBD1
Gene Full NameMethyl-CpG binding domain protein 1
Alias SymbolsRFT, PCM1, CXXC3
NCBI Gene Id4152
Protein NameMethyl-CpG-binding domain protein 1
Description of TargetMBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.
Uniprot IDQ9UIS9-2
Protein Accession #NP_056670
Nucleotide Accession #NM_015845
Protein Size (# AA)586
Molecular Weight65kDa
Protein InteractionsSUMO1; HTT; UBC; ECT2; APP; ATXN1L; TENM1; SUMO2; HIST1H3A; PCNA; ATF7IP2; ATF7IP; CHAF1A; SETDB1; PIAS1; STAT1; PRAM1; HDAC3; PIAS2; ZNF512B; Rnf2; CBX4; CBX5; HIPK3; SMAD9; OASL; SMAD5; SMAD3; SMAD7; SMAD1; SUV39H1;
  1. What is the species homology for "MBD1 Antibody - middle region (ARP40172_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog".

  2. How long will it take to receive "MBD1 Antibody - middle region (ARP40172_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MBD1 Antibody - middle region (ARP40172_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MBD1 Antibody - middle region (ARP40172_P050)"?

    This target may also be called "RFT, PCM1, CXXC3" in publications.

  5. What is the shipping cost for "MBD1 Antibody - middle region (ARP40172_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MBD1 Antibody - middle region (ARP40172_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MBD1 Antibody - middle region (ARP40172_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MBD1 Antibody - middle region (ARP40172_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MBD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MBD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MBD1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MBD1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MBD1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MBD1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MBD1 Antibody - middle region (ARP40172_P050)
Your Rating
We found other products you might like!