ING3 Antibody - middle region (ARP33347_P050)

Catalog No: ARP33347_P050

WB Suggested Anti-ING3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ING3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ING3 (ARP33347_P050) antibody is Catalog # AAP33347 (Previous Catalog # AAPP04389)
• Reference: Gunduz,M., (2008) Cancer Sci. 99 (3), 531-538

Target Info

• Gene Symbol: ING3
• Gene Full Name: Inhibitor of growth family, member 3
• Alias Symbols: Eaf4, ING2, MEAF4, p47ING3
• NCBI Gene Id: 54556
• Protein Name: Inhibitor of growth protein 3
• Description of Target: ING3 is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers.The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed.
• Uniprot ID: Q9NXR8
• Protein Accession #: NP_061944
• Nucleotide Accession #: NM_019071
• Protein Size (# AA): 418
• Molecular Weight: 47kDa
• Protein Interactions: USHBP1; TRIM54; TEX11; FBXO25; APP; H2AFZ; ELAVL1; NR1H3; NR1H2; DMAP1; MORF4L1; KAT5; RBX1; RUVBL1; CUL1; TRRAP; UBC; SKP2; ACTL6A; EPC1; HHT2; HHT1; MEAF6; EPC2; BRD8; RUVBL2; YEATS4;