SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42207_P050
Price: $0.00
SKU
ARP42207_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-IGFALS (ARP42207_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human IGFALS
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE
Concentration0.5 mg/ml
Blocking PeptideFor anti-IGFALS (ARP42207_P050) antibody is Catalog # AAP42207 (Previous Catalog # AAPP24630)
ReferenceHeath,K.E., (2008) J. Clin. Endocrinol. Metab. 93 (5), 1616-1624
Gene SymbolIGFALS
Gene Full NameInsulin-like growth factor binding protein, acid labile subunit
Alias SymbolsALS, ACLSD
NCBI Gene Id3483
Protein NameInsulin-like growth factor-binding protein complex acid labile subunit
Description of TargetAdaptor proteins are usually required for transcriptional activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter.TADA3L is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis.
Uniprot IDP35858
Protein Accession #NP_004961
Nucleotide Accession #NM_004970
Protein Size (# AA)605
Molecular Weight63kDa
Protein InteractionsPDCD6; IGF1; IGFBP5; IGFBP3;
  1. What is the species homology for "IGFALS Antibody - middle region (ARP42207_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Guinea Pig".

  2. How long will it take to receive "IGFALS Antibody - middle region (ARP42207_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IGFALS Antibody - middle region (ARP42207_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IGFALS Antibody - middle region (ARP42207_P050)"?

    This target may also be called "ALS, ACLSD" in publications.

  5. What is the shipping cost for "IGFALS Antibody - middle region (ARP42207_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IGFALS Antibody - middle region (ARP42207_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IGFALS Antibody - middle region (ARP42207_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IGFALS Antibody - middle region (ARP42207_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IGFALS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IGFALS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IGFALS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IGFALS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IGFALS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IGFALS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IGFALS Antibody - middle region (ARP42207_P050)
Your Rating
We found other products you might like!