DFFB Antibody - middle region (ARP52046_P050)

Catalog No: ARP52046_P050

WB Suggested Anti-DFFB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DFFB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DFFB (ARP52046_P050) antibody is Catalog # AAP52046 (Previous Catalog # AAPP30271)
• Subunit: beta
• Reference: Neimanis,S., (2007) J. Biol. Chem. 282 (49), 35821-35830

Target Info

• Gene Symbol: DFFB
• Gene Full Name: DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
• Alias Symbols: CAD, CPAN, DFF2, DFF40, DFF-40
• NCBI Gene Id: 1677
• Protein Name: DNA fragmentation factor subunit beta
• Description of Target: DFFB is a nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. DFFB degrades naked DNA and induces apoptotic morphology.Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene but the biological validity of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O76075
• Protein Accession #: NP_004393
• Nucleotide Accession #: NM_004402
• Protein Size (# AA): 338
• Molecular Weight: 39kDa
• Protein Interactions: DFFA; UBC; NUBP1; MARCKS; APP; CAND1; COPS5; CUL1; CUL2; CUL5; NEDD8; CIDEB; DFFB; TOP2A;